ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4680

Name

CEACAM6

Synonym

CD66c|CEAL|NCA;carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen);CEACAM6;carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)

Definition

Cluster of Differentiation 66c|carcinoembryonic antigen-related cell adhesion molecule 6|normal cross-reacting antigen

Position

19q13.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4680

Links to epithelial mesenchymal transition gene database

4680

Links to ovarian cancer gene database

4680

Links to endometrial cancer gene database

4680

Links to iHOP

4680

Sequence Information

Nucleotide Sequence

>4680 : length: 2601
GAGGCTCAGCACAGAAGGAGGAAGGACAGCAGGGCCAACAGTCACAGCAGCCCTGACCAG
AGCATTCCTGGAGCTCAAGCTCCTCTACAAAGAGGTGGACAGAGAAGACAGCAGAGACCA
TGGGACCCCCCTCAGCCCCTCCCTGCAGATTGCATGTCCCCTGGAAGGAGGTCCTGCTCA
CAGCCTCACTTCTAACCTTCTGGAACCCACCCACCACTGCCAAGCTCACTATTGAATCCA
CGCCGTTCAATGTCGCAGAGGGGAAGGAGGTTCTTCTACTCGCCCACAACCTGCCCCAGA
ATCGTATTGGTTACAGCTGGTACAAAGGCGAAAGAGTGGATGGCAACAGTCTAATTGTAG
GATATGTAATAGGAACTCAACAAGCTACCCCAGGGCCCGCATACAGTGGTCGAGAGACAA
TATACCCCAATGCATCCCTGCTGATCCAGAACGTCACCCAGAATGACACAGGATTCTATA
CCCTACAAGTCATAAAGTCAGATCTTGTGAATGAAGAAGCAACCGGACAGTTCCATGTAT
ACCCGGAGCTGCCCAAGCCCTCCATCTCCAGCAACAACTCCAACCCCGTGGAGGACAAGG
ATGCTGTGGCCTTCACCTGTGAACCTGAGGTTCAGAACACAACCTACCTGTGGTGGGTAA
ATGGTCAGAGCCTCCCGGTCAGTCCCAGGCTGCAGCTGTCCAATGGCAACATGACCCTCA
CTCTACTCAGCGTCAAAAGGAACGATGCAGGATCCTATGAATGTGAAATACAGAACCCAG
CGAGTGCCAACCGCAGTGACCCAGTCACCCTGAATGTCCTCTATGGCCCAGATGTCCCCA
CCATTTCCCCCTCAAAGGCCAATTACCGTCCAGGGGAAAATCTGAACCTCTCCTGCCACG
CAGCCTCTAACCCACCTGCACAGTACTCTTGGTTTATCAATGGGACGTTCCAGCAATCCA
CACAAGAGCTCTTTATCCCCAACATCACTGTGAATAATAGCGGATCCTATATGTGCCAAG
CCCATAACTCAGCCACTGGCCTCAATAGGACCACAGTCACGATGATCACAGTCTCTGGAA
GTGCTCCTGTCCTCTCAGCTGTGGCCACCGTCGGCATCACGATTGGAGTGCTGGCCAGGG
TGGCTCTGATATAGCAGCCCTGGTGTATTTTCGATATTTCAGGAAGACTGGCAGATTGGA
CCAGACCCTGAATTCTTCTAGCTCCTCCAATCCCATTTTATCCCATGGAACCACTAAAAA
CAAGGTCTGCTCTGCTCCTGAAGCCCTATATGCTGGAGATGGACAACTCAATGAAAATTT
AAAGGGAAAACCCTCAGGCCTGAGGTGTGTGCCACTCAGAGACTTCACCTAACTAGAGAC
AGTCAAACTGCAAACCATGGTGAGAAATTGACGACTTCACACTATGGACAGCTTTTCCCA
AGATGTCAAAACAAGACTCCTCATCATGATAAGGCTCTTACCCCCTTTTAATTTGTCCTT
GCTTATGCCTGCCTCTTTCGCTTGGCAGGATGATGCTGTCATTAGTATTTCACAAGAAGT
AGCTTCAGAGGGTAACTTAACAGAGTGTCAGATCTATCTTGTCAATCCCAACGTTTTACA
TAAAATAAGAGATCCTTTAGTGCACCCAGTGACTGACATTAGCAGCATCTTTAACACAGC
CGTGTGTTCAAATGTACAGTGGTCCTTTTCAGAGTTGGACTTCTAGACTCACCTGTTCTC
ACTCCCTGTTTTAATTCAACCCAGCCATGCAATGCCAAATAATAGAATTGCTCCCTACCA
GCTGAACAGGGAGGAGTCTGTGCAGTTTCTGACACTTGTTGTTGAACATGGCTAAATACA
ATGGGTATCGCTGAGACTAAGTTGTAGAAATTAACAAATGTGCTGCTTGGTTAAAATGGC
TACACTCATCTGACTCATTCTTTATTCTATTTTAGTTGGTTTGTATCTTGCCTAAGGTGC
GTAGTCCAACTCTTGGTATTACCCTCCTAATAGTCATACTAGTAGTCATACTCCCTGGTG
TAGTGTATTCTCTAAAAGCTTTAAATGTCTGCATGCAGCCAGCCATCAAATAGTGAATGG
TCTCTCTTTGGCTGGAATTACAAAACTCAGAGAAATGTGTCATCAGGAGAACATCATAAC
CCATGAAGGATAAAAGCCCCAAATGGTGGTAACTGATAATAGCACTAATGCTTTAAGATT
TGGTCACACTCTCACCTAGGTGAGCGCATTGAGCCAGTGGTGCTAAATGCTACATACTCC
AACTGAAATGTTAAGGAAGAAGATAGATCCAATTAAAAAAAATTAAAACCAATTTAAAAA
AAAAAAGAACACAGGAGATTCCAGTCTACTTGAGTTAGCATAATACAGAAGTCCCCTCTA
CTTTAACTTTTACAAAAAAGTAACCTGAACTAATCTGATGTTAACCAATGTATTTATTTC
TGTGGTTCTGTTTCCTTGTTCCAATTTGACAAAACCCACTGTTCTTGTATTGTATTGCCC
AGGGGGAGCTATCACTGTACTTGTAGAGTGGTGCTGCTTTAATTCATAAATCACAAATAA
AAGCCAATTAGCTCTATAACT

Protein Sequence

>4680 : length: 344
MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQ
NRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFY
TLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWV
NGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGP
TISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ
AHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI