ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

467

Name

ATF3

Synonym

activating transcription factor 3;ATF3;activating transcription factor 3

Definition

cAMP-dependent transcription factor ATF-3|cyclic AMP-dependent transcription factor ATF-3

Position

1q32.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

PERK regulated gene expression;PID Reactome;500132

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

ATF-2 transcription factor network;PID Curated;200116

Disease

Embryoma;FunDO

Disease

Prostate cancer;FunDO

Disease

Primary tumor;FunDO

Disease

Nephroblastoma;FunDO

Disease

Infection;FunDO

Disease

Hyperhomocysteinemia;FunDO

Disease

Congenital abnormality;FunDO

Disease

Colon cancer;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

467

Links to epithelial mesenchymal transition gene database

467

Links to ovarian cancer gene database

467

Links to endometrial cancer gene database

467

Links to iHOP

467

Sequence Information

Nucleotide Sequence

>467 : length: 2400
TCCGCTCCGTTCGGCCGGTTCTCCCGGGAAGCTATTAATAGCATTACGTCAGCCTGGGAC
TGGCAACACGGAGTAAACGACCGCGCCGCCAGCCTGAGGGCTATAAAAGGGGTGATGCAA
CGCTCTCCAAGCCACAGTCGCACGCAGCCAGGCGCGCACTGCACAGCTCTCTTCTCTCGC
CGCCGCCCGAGCGCACCCTTCAGCCCGCGCGCCGGCCGTGAGTCCTCGGTGCTCGCCCGC
CGGCCAGACAAACAGCCCGCCCGACCCCGTCCCGACCCTGGCCGCCCCGAGCGGAGCCTG
GAGCAAAATGATGCTTCAACACCCAGGCCAGGTCTCTGCCTCGGAAGTGAGTGCTTCTGC
CATCGTCCCCTGCCTGTCCCCTCCTGGGTCACTGGTGTTTGAGGATTTTGCTAACCTGAC
GCCCTTTGTCAAGGAAGAGCTGAGGTTTGCCATCCAGAACAAGCACCTCTGCCACCGGAT
GTCCTCTGCGCTGGAATCAGTCACTGTCAGCGACAGACCCCTCGGGGTGTCCATCACAAA
AGCCGAGGTAGCCCCTGAAGAAGATGAAAGGAAAAAGAGGCGACGAGAAAGAAATAAGAT
TGCAGCTGCAAAGTGCCGAAACAAGAAGAAGGAGAAGACGGAGTGCCTGCAGAAACTCCC
AAGGCCCTTTTGGGTCCAGAAGACCTGCATATGGGCTGTTGACTCATGCAAATGAGGTAT
CTGAACTGCAGCTTCAGTATTAGCAGAGCCACAGGCCGCCTCTGTGGCATCACCAGGGTT
TCTCTGAAGAAGAGGGTCTGCATTTTCCTAAACCCAGTGCTGCTCTCCCATCTCCCATCT
TCCTCTCGCAGCTTGATGAGCCCCGGTGTGTCCCAGGTACACCCCTGCATCCAGGCAGCA
GCCCAGGCCACCCCCTCCTCACTGGCCCTTGGCTCCTTTCTTGATGCCTCTGTTGCTTGT
CCCCCAGGAGTCGGAGAAGCTGGAAAGTGTGAATGCTGAACTGAAGGCTCAGATTGAGGA
GCTCAAGAACGAGAAGCAGCATTTGATATACATGCTCAACCTTCATCGGCCCACGTGTAT
TGTCCGGGCTCAGAATGGGAGGACTCCAGAAGATGAGAGAAACCTCTTTATCCAACAGAT
AAAAGAAGGAACATTGCAGAGCTAAGCAGTCGTGGTATGGGGGCGACTGGGGAGTCCTCA
TTGAATCCTCATTTTATACCCAAAACCCTGAAGCCATTGGAGAGCTGTCTTCCTGTGTAC
CTCTAGAATCCCAGCAGCAGAGAACCATCAAGGCGGGAGGGCCTGCAGTGATTCAGCAGG
CCCTTCCCATTCTGCCCCAGAGTGGGTCTTGGACCAGGGCAAGTGCATCTTTGCCTCAAC
TCCAGGATTTAGGCCTTAACACACTGGCCATTCTTATGTTCCAGATGGCCCCCAGCTGGT
GTCCTGCCCGCCTTTCATCTGGATTCTACAAAAAACCAGGATGCCCACCGTTAGGATTCA
GGCAGCAGTGTCTGTACCTCGGGTGGGAGGGATGGGGCCATCTCCTTCACCGTGGCTACC
ATTGTCACTCGTAGGGGATGTGGAGTGAGAACAGCATTTAGTGAAGTTGTGCAACGGCCA
GGGTTGTGCTTTCTAGCAAATATGCTGTTATGTCCAGAAATTGTGTGTGCAAGAAAACTA
GGCAATGTACTCTTCCGATGTTTGTGTCACACAACACTGATGTGACTTTTATATGCTTTT
TCTCAGATCTGGTTTCTAAGAGTTTTGGGGGGCGGGGCTGTCACCACGTGCAGTATCTCA
AGATATTCAGGTGGCCAGAAGAGCTTGTCAGCAAGAGGAGGACAGAATTCTCCCAGCGTT
AACACAAAATCCATGGGCAGTATGATGGCAGGTCCTCTGTTGCAAACTCAGTTCCAAAGT
CACAGGAAGAAAGCAGAAAGTTCAACTTCCAAAGGGTTAGGACTCTCCACTCAATGTCTT
AGGTCAGGAGTTGTGTCTAGGCTGGAAGAGCCAAAGAATATTCCATTTTCCTTTCCTTGT
GGTTGAAAACCACAGTCAGTGGAGAGATGTTTGGAAACCACAGTCAGTGGAGCCTGGGTG
GTACCCAGGCTTTAGCATTATTGGATGTCAATAGCATTGTTTTTGTCATGTAGCTGTTTT
AAGAAATCTGGCCCAGGGTGTTTGCAGCTGTGAGAAGTCACTCACACTGGCCACAAGGAC
GCTGGCTACTGTCTATTAAAATTCTGATGTTTCTGTGAAATTCTCAGAGTGTTTAATTGT
ACTCAATGGTATCATTACAATTTTCTGTAAGAGAAAATATTACTTATTTATCCTAGTATT
CCTAACCTGTCAGAATAATAAATATTGGAACCAAGACATGGTAAACAAAAAAAAAAAAAA

Protein Sequence

>467 : length: 181
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
S