ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

466

Name

ATF1

Synonym

EWS-ATF1|FUS/ATF-1|TREB36;activating transcription factor 1;ATF1;activating transcription factor 1

Definition

cAMP-dependent transcription factor ATF-1|cyclic AMP-dependent transcription factor ATF-1

Position

12q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

CREB phosphorylation;PID Reactome;500457

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

tnf/stress related signaling;PID BioCarta;100026

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Signaling mediated by p38-alpha and p38-beta;PID Curated;200154

Pathway

Signalling by NGF;Reactome;REACT:11061

Disease

Cancers;KEGG DISEASE

Disease

Sarcoma;FunDO

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Adenovirus infection;FunDO

Disease

Clear cell carcinoma;FunDO

Disease

Clear cell sarcoma of soft tissue;KEGG DISEASE;H00052

External Links

Links to cell senescence gene database

466

Links to epithelial mesenchymal transition gene database

466

Links to ovarian cancer gene database

466

Links to endometrial cancer gene database

466

Links to iHOP

466

Sequence Information

Nucleotide Sequence

>466 : length: 2505
ATAGCCTACCCCAAACGCACACTAGTGCTCAGTTTTGCCCCCCTCCCCTCCCCCGCCCCC
GCCCCCGCCCCCAGGCTTGTGTAGATCATGCCGCCAGTAGCGGCCCTGACTGCCGAGGAA
ACGGTAGCTTAGGACAGTTGGCTGTTAAGTGACACTGATTCTCCCCGCCCCGCCTGACCC
CCGAGAAGGAGGCTTGTCCCCCGCTGCGTGAGGGGGTGGGGAAGTGGGTAGTGAATTCGG
ATCTACCTGGGAGGGGGGAGTGGAAGTTCCCGCCCCGGAGAGCGGCGAGGCGGCAGCCAC
AGTTGATTATGGAAGATTCCCACAAGAGTACCACGTCAGAGACAGCACCTCAACCTGGTT
CAGCAGTTCAGGGAGCTCACATTTCTCATATTGCTCAACAGGTATCATCTTTATCAGAAA
GTGAGGAGTCCCAGGACTCATCCGACAGCATAGGCTCCTCACAGAAAGCCCACGGGATCC
TAGCACGGCGCCCATCTTACAGAAAAATTTTGAAAGACTTATCTTCTGAAGATACACGGG
GCAGAAAAGGAGACGGAGAAAATTCTGGAGTTTCTGCTGCTGTCACTTCTATGTCTGTTC
CAACTCCCATCTATCAGACTAGCAGCGGACAGTACATTGCCATTGCCCCAAATGGAGCCT
TACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAA
ATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGAC
AGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAA
CATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACAT
CTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAA
TAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATG
TGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAG
AGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAA
TATTTTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAA
AGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCA
CGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACT
GGAAGCTTTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAA
ATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAGAGAAGATGAAATTTGATAAA
CTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTAC
CTTTTTTTAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAAT
TACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATATAAAGTATATGTTCTGATTAT
GTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACT
TGAATGGATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAA
GGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTATCAGAATGGAAAAAGAACTG
TTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCT
ACAAATACATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATT
ACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAGGCCCTTAAAATATTATTTTT
AAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAA
TAATGTAAGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAG
ACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAAGTGACTGCCAATATATTTTT
ATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATAT
AGTTTAGTAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTG
GCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTAAAATTCAAAAATACTGTCAG
TACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAA
CTATTGTGTGCTCTTACACAGTATGCATCATATTGTTGTCTGTGAAATTAAAGGACATTT
GATAGTCTACTGAATGTAAAATATAATGCTTGGTATATGAATGAT

Protein Sequence

>466 : length: 271
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
RPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQL
ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQ
IRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKC
LENRVAVLENQNKTLIEELKTLKDLYSNKSV