ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4615

Name

MYD88

Synonym

MYD88D;myeloid differentiation primary response 88;MYD88;myeloid differentiation primary response 88

Definition

myeloid differentiation primary response gene (88)|myeloid differentiation primary response protein MyD88

Position

3p22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

signal transduction through il1r;PID BioCarta;100132

Pathway

toll-like receptor pathway;PID BioCarta;100013

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

MyD88 cascade;PID Reactome;500445

Pathway

nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088

Pathway

Endogenous TLR signaling;PID Curated;200177

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

nf-kb signaling pathway;PID BioCarta;100097

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Disease

Gram-Negative bacterial infection;FunDO

Disease

Rheumatism;FunDO

Disease

Ovarian cancer;FunDO

Disease

Pyogenic bacterial infections, recurrent, due to MYD88 deficiency;OMIM

External Links

Links to cell senescence gene database

4615

Links to epithelial mesenchymal transition gene database

4615

Links to ovarian cancer gene database

4615

Links to endometrial cancer gene database

4615

Links to iHOP

4615

Sequence Information

Nucleotide Sequence

>4615 : length: 2886
AGATTCCTACTTCTTACGCCCCCCACATCACCCGCCTCGAGACCTCAAGGGTAGAGGTGG
GCACCCCCGCCTCCGCACTTTTGCTCGGGGCTCCAGATTGTAGGGCAGGGCGGCGCTTCT
CGGAAAGCGAAAGCCGGCGGGGCGGGGCGGGTGCCGCAGGAGAAAGAGGAAGCGCTGGCA
GACAATGCGACCCGACCGCGCTGAGGCTCCAGGACCGCCCGCCATGGCTGCAGGAGGTCC
CGGCGCGGGGTCTGCGGCCCCGGTCTCCTCCACATCCTCCCTTCCCCTGGCTGCTCTCAA
CATGCGAGTGCGGCGCCGCCTGTCTCTGTTCTTGAACGTGCGGACACAGGTGGCGGCCGA
CTGGACCGCGCTGGCGGAGGAGATGGACTTTGAGTACTTGGAGATCCGGCAACTGGAGAC
ACAAGCGGACCCCACTGGCAGGCTGCTGGACGCCTGGCAGGGACGCCCTGGCGCCTCTGT
AGGCCGACTGCTCGAGCTGCTTACCAAGCTGGGCCGCGACGACGTGCTGCTGGAGCTGGG
ACCCAGCATTGAGGAGGATTGCCAAAAGTATATCTTGAAGCAGCAGCAGGAGGAGGCTGA
GAAGCCTTTACAGGTGGCCGCTGTAGACAGCAGTGTCCCACGGACAGCAGAGCTGGCGGG
CATCACCACACTTGATGACCCCCTGGGGCATATGCCTGAGCGTTTCGATGCCTTCATCTG
CTATTGCCCCAGCGACATCCAGTTTGTGCAGGAGATGATCCGGCAACTGGAACAGACAAA
CTATCGACTGAAGTTGTGTGTGTCTGACCGCGATGTCCTGCCTGGCACCTGTGTCTGGTC
TATTGCTAGTGAGCTCATCGAAAAGAGGTTGGCTAGAAGGCCACGGGGTGGGTGCCGCCG
GATGGTGGTGGTTGTCTCTGATGATTACCTGCAGAGCAAGGAATGTGACTTCCAGACCAA
ATTTGCACTCAGCCTCTCTCCAGGTGCCCATCAGAAGCGACTGATCCCCATCAAGTACAA
GGCAATGAAGAAAGAGTTCCCCAGCATCCTGAGGTTCATCACTGTCTGCGACTACACCAA
CCCCTGCACCAAATCTTGGTTCTGGACTCGCCTTGCCAAGGCCTTGTCCCTGCCCTGAAG
ACTGTTCTGAGGCCCTGGGTGTGTGTGTATCTGTCTGCCTGTCCATGTACTTCTGCCCTG
CCTCCTCCTTTCGTTGTAGGAGGAATCTGTGCTCTACTTACCTCTCAATTCCTGGAGATG
CCAACTTCACAGACACGTCTGCAGCAGCTGGACATCACATTTCATGTCCTGCATGGAACC
AGTGGCTGTGAGTGGCATGTCCACTTGCTGGATTATCAGCCAGGACACTATAGAACAGGA
CCAGCTGAGACTAAGAAGGACCAGCAGAGCCAGCTCAGCTCTGAGCCATTCACACATCTT
CACCCTCAGTTTCCTCACTTGAGGAGTGGGATGGGGAGAACAGAGAGTAGCTGTGTTTGA
ATCCCTGTAGGAAATGGTGAAGCATAGCTCTGGGTCTCCTGGGGGAGACCAGGCTTGGCT
GCGGGAGAGCTGGCTGTTGCTGGACTACATGCTGGCCACTGCTGTGACCACGACACTGCT
GGGGCAGCTTCTTCCACAGTGATGCCTACTGATGCTTCAGTGCCTCTGCACACCGCCCAT
TCCACTTCCTCCTTCCCCACAGGGCAGGTGGGGAAGCAGTTTGGCCCAGCCCAAGGAGAC
CCCACCTTGAGCCTTATTTCCTAATGGGTCCACCTCTCATCTGCATCTTTCACACCTCCC
AGCTTCTGCCCAACCTTCAGCAGTGACAAGTCCCCAAGAGACTCGCCTGAGCAGCTTGGG
CTGCTTTTCATTTCCACCTGTCAGGATGCCTGTGGTCATGCTCTCAGCTCCACCTGGCAT
GAGAAGGGATCCTGGCCTCTGGCATATTCATCAAGTATGAGTTCTGGGGATGAGTCACTG
TAATGATGTGAGCAGGGAGCCTTCCTCCCTGGGCCACCTGCAGAGAGCTTTCCCACCAAC
TTTGTACCTTGATTGCCTTACAAAGTTATTTGTTTACAAACAGCGACCATATAAAAGCCT
CCTGCCCCAAAGCTTGTGGGCACATGGGCACATACAGACTCACATACAGACACACACATA
TATGTACAGACATGTACTCTCACACACACAGGCACCAGCATACACACGTTTTTCTAGGTA
CAGCTCCCAGGAACAGCTAGGTGGGAAAGTCCCATCACTGAGGGAGCCTAACCATGTCCC
TGAACAAAAATTGGGCACTCATCTATTCCTTTTCTCTTGTGTCCCTACTCATTGAAACCA
AACTCTGGAAAGGACCCAATGTACCAGTATTTATACCTCTAATGAAGCACAGAGAGAGGA
AGAGAGCTGCTTAAACTCACACAACAATGAACTGCAGACACAGCTGTTCTCTCCCTCTCT
CCTTCCCAGAGCAATTTATACTTTACCCTCAGGCTGTCCTCTGGGGAGAAGGTGCCATGG
TCTTAGGTGTCTGTGCCCCAGGACAGACCCTAGGACCCTAAATCCAATAGAAAATGCATA
TCTTTGCTCCACTTTCAGCCAGGCTGGAGCAAGGTACCTTTTCTTAGGATCTTGGGAGGG
AATGGATGCCCCTCTCTGCATGATCTTGTTGAGGCATTTAGCTGCCATGCACCTGTCCCC
CTTTAATACTGGGCATTTTAAAGCCATCTCAAGAGGCATCTTCTACATGTTTTGTACGCA
TTAAAATAATTTCAAAGATATCTGAGAAAAGCCGATATTTGCCATTCTTCCTATATCCTG
GAATATATCTTGCATCCTGAGTTTATAATAATAAATAATATTCTACCTTGGAAAAAAAAA
AAAAAA

Protein Sequence

>4615 : length: 317
MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICY
CPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRLARRPRGGCRRM
VVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNP
CTKSWFWTRLAKALSLP