ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4613

Name

MYCN

Synonym

MODED|N-myc|NMYC|ODED|bHLHe37;v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog;MYCN;v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog

Definition

N-myc proto-oncogene protein|class E basic helix-loop-helix protein 37|neuroblastoma MYC oncogene|neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene|oncogene NMYC|pp65/67

Position

2p24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;PANTHER;P00057

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Lung disease;FunDO

Disease

Neuroblastoma;KEGG DISEASE;H00043

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Penile cancer;KEGG DISEASE;H00025

Disease

Feingold syndrome;OMIM

Disease

Cancer;FunDO

Disease

rapid progression of neuroblastomas;GAD

Disease

Microcephaly and digital abnormalities with normal intelligence;OMIM

External Links

Links to cell senescence gene database

4613

Links to epithelial mesenchymal transition gene database

4613

Links to ovarian cancer gene database

4613

Links to endometrial cancer gene database

4613

Links to iHOP

4613

Sequence Information

Nucleotide Sequence

>4613 : length: 3046
GCTTTCCTCTCCTTTCTCCCTCCCCCTTGTCTGCGCCACAGCCCCCTTCTCTCCCCGCCC
CCCGGGTGTGTCAGATTTTTCAGTTAATAATATCCCCCGAGCTTCAAAGCGCAGGCTGTG
ACAGTCATCTGTCTGGACGCGCTGGGTGGATGCGGGGGGCTCCTGGGAACTGTGTTGGAG
CCGAGCAAGCGCTAGCCAGGCGCAAGCGCGCACAGACTGTAGCCATCCGAGGACACCCCC
GCCCCCCCGGCCCACCCGGAGACACCCGCGCAGAATCGCCTCCGGATCCCCTGCAGTCGG
CGGGAGGTAAGGAGCAGGGCTTGCAAACCGCCCGGCGCCCAGGGAAGCGACGAGCGCCGG
GGCAAGGCAAGCCCTGGACGGGATTGCGACGTGCGCACCGGGCGCCCTAATATGCCCGGG
GGACTGTTTCTGCTTCCGAAACAAAACCATCTCTGGGTTTTCCCAGAAAAGCCAGTTCCA
GCCCCGAAGGCATCCTGGCTAGAGGAGACCCGCCCTAATCCTTTTGCAGCCCTTACCGGG
GGGAGTAATGGCTTCTGCGAAAAGAAATTCCCTCGGCTCTAGAAGATCTGTCTGTGTTTG
AGCTGTCGGAGAGCCGTGTTGGAGGTCGGCGCCGGCCCCCGCCTTCCGCGCCCCCCACGG
GAAGGAAGCACCCCCGGTATTAAAACGAACGGGGCGGAAAGAAGCCCTCAGTCGCCGGCC
GGGAGGCGAGCCGATGCCGAGCTGCTCCACGTCCACCATGCCGGGCATGATCTGCAAGAA
CCCAGACCTCGAGTTTGACTCGCTACAGCCCTGCTTCTACCCGGACGAAGATGACTTCTA
CTTCGGCGGCCCCGACTCGACCCCCCCGGGGGAGGACATCTGGAAGAAGTTTGAGCTGCT
GCCCACGCCCCCGCTGTCGCCCAGCCGTGGCTTCGCGGAGCACAGCTCCGAGCCCCCGAG
CTGGGTCACGGAGATGCTGCTTGAGAACGAGCTGTGGGGCAGCCCGGCCGAGGAGGACGC
GTTCGGCCTGGGGGGACTGGGTGGCCTCACCCCCAACCCGGTCATCCTCCAGGACTGCAT
GTGGAGCGGCTTCTCCGCCCGCGAGAAGCTGGAGCGCGCCGTGAGCGAGAAGCTGCAGCA
CGGCCGCGGGCCGCCAACCGCCGGTTCCACCGCCCAGTCCCCGGGAGCCGGCGCCGCCAG
CCCTGCGGGTCGCGGGCACGGCGGGGCTGCGGGAGCCGGCCGCGCCGGGGCCGCCCTGCC
CGCCGAGCTCGCCCACCCGGCCGCCGAGTGCGTGGATCCCGCCGTGGTCTTCCCCTTTCC
CGTGAACAAGCGCGAGCCAGCGCCCGTGCCCGCAGCCCCGGCCAGTGCCCCGGCGGCGGG
CCCTGCGGTCGCCTCGGGGGCGGGTATTGCCGCCCCAGCCGGGGCCCCGGGGGTCGCCCC
TCCGCGCCCAGGCGGCCGCCAGACCAGCGGCGGCGACCACAAGGCCCTCAGTACCTCCGG
AGAGGACACCCTGAGCGATTCAGATGATGAAGATGATGAAGAGGAAGATGAAGAGGAAGA
AATCGACGTGGTCACTGTGGAGAAGCGGCGTTCCTCCTCCAACACCAAGGCTGTCACCAC
ATTCACCATCACTGTGCGTCCCAAGAACGCAGCCCTGGGTCCCGGGAGGGCTCAGTCCAG
CGAGCTGATCCTCAAACGATGCCTTCCCATCCACCAGCAGCACAACTATGCCGCCCCCTC
TCCCTACGTGGAGAGTGAGGATGCACCCCCACAGAAGAAGATAAAGAGCGAGGCGTCCCC
ACGTCCGCTCAAGAGTGTCATCCCCCCAAAGGCTAAGAGCTTGAGCCCCCGAAACTCTGA
CTCGGAGGACAGTGAGCGTCGCAGAAACCACAACATCCTGGAGCGCCAGCGCCGCAACGA
CCTTCGGTCCAGCTTTCTCACGCTCAGGGACCACGTGCCGGAGTTGGTAAAGAATGAGAA
GGCCGCCAAGGTGGTCATTTTGAAAAAGGCCACTGAGTATGTCCACTCCCTCCAGGCCGA
GGAGCACCAGCTTTTGCTGGAAAAGGAAAAATTGCAGGCAAGACAGCAGCAGTTGCTAAA
GAAAATTGAACACGCTCGGACTTGCTAGACGCTTCTCAAAACTGGACAGTCACTGCCACT
TTGCACATTTTGATTTTTTTTTTAAACAAACATTGTGTTGACATTAAGAATGTTGGTTTA
CTTTCAAATCGGTCCCCTGTCGAGTTCGGCTCTGGGTGGGCAGTAGGACCACCAGTGTGG
GGTTCTGCTGGGACCTTGGAGAGCCTGCATCCCAGGATGCTGGGTGGCCCTGCAGCCTCC
TCCACCTCACCTCCATGACAGCGCTAAACGTTGGTGACGGTTGGGAGCCTCTGGGGCTGT
TGAAGTCACCTTGTGTGTTCCAAGTTTCCAAACAACAGAAAGTCATTCCTTCTTTTTAAA
ATGGTGCTTAAGTTCCAGCAGATGCCACATAAGGGGTTTGCCATTTGATACCCCTGGGGA
ACATTTCTGTAAATACCATTGACACATCCGCCTTTTGTATACATCCTGGGTAATGAGAGG
TGGCTTTTGCGGCCAGTATTAGACTGGAAGTTCATACCTAAGTACTGTAATAATACCTCA
ATGTTTGAGGAGCATGTTTTGTATACAAATATATTGTTAATCTCTGTTATGTACTGTACT
AATTCTTACACTGCCTGTATACTTTAGTATGACGCTGATACATAACTAAATTTGATACTT
ATATTTTCGTATGAAAATGAGTTGTGAAAGTTTTGAGTAGATATTACTTTATCACTTTTT
GAACTAAGAAACTTTTGTAAAGAAATTTACTATATATATATGCCTTTTTCCTAGCCTGTT
TCTTCCTGTTAATGTATTTGTTCATGTTTGGTGCATAGAACTGGGTAAATGCAAAGTTCT
GTGTTTAATTTCTTCAAAATGTATATATTTAGTGCTGCATCTTATAGCACTTTGAAATAC
CTCATGTTTATGAAAATAAATAGCTTAAAATTAAATGAAAAAAAAA

Protein Sequence

>4613 : length: 464
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC