ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4610

Name

MYCL

Synonym

LMYC|MYCL1|bHLHe38;v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog;MYCL;v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog

Definition

class E basic helix-loop-helix protein 38|l-myc-1 proto-oncogene|myc-related gene from lung cancer|protein L-Myc|protein L-Myc-1|v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived

Position

1p34.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;PANTHER;P00057

Disease

lung cancer susceptibility and prognosis;GAD

Disease

esophageal cancer;GAD

Disease

lung cancer;GAD

Disease

gastric cancer;GAD

Disease

breast cancer;GAD

Disease

cancer;GAD

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

stomach cancer;GAD

Disease

colorectal cancer;GAD

External Links

Links to cell senescence gene database

4610

Links to epithelial mesenchymal transition gene database

4610

Links to ovarian cancer gene database

4610

Links to endometrial cancer gene database

4610

Links to iHOP

4610

Sequence Information

Nucleotide Sequence

>4610 : length: 3624
AATGCGCCTGCAGCTCGCGCTCCCGCGCCGATCCCGAGAGCGTCCGGGCCGCCGTGCGCG
AGCGAGGGAGGGCGCGCGCGCGGGGGGGGCGCGCTTGTGAGTGCGGGCCGCGCTCTCGGC
GGCGCGCATGTGCGTGTGTGCTGGCTGCCGGGCTGCCCCGAGCCGGCGGGGAGCCGGTCC
GCTCCAGGTGGCGGGCGGCTGGAGCGAGGTGAGGCTGCGGGTGGCCAGGGCACGGGCGCG
GGTCCCGCGGTGCGGGCTGGCTGCAGGCTGCCTTCTGGGCACGGCGCGCCCCCGCCCGGC
CCCGCCGGGCCCTGGGAGCTGCGCTCCGGGCGGCGCTGGCAAAGTTTGCTTTGAACTCGC
TGCCCACAGTCGGGTCCGCGCGCTGCGATTGGCTTCCCCTACCACTCTGACCCGGGGCCC
GGCTTCCCGGGACGCGAGGACTGGGCGCAGGCTGCAAGCTGGTGGGGTTGGGGAGGAACG
AGAGCCCGGCAGCCGACTGTGCCGAGGGACCCGGGGACACCTCCTTCGCCCGGCCGGCAC
CCGGTCAGCACGTCCCCCCTTCCCTCCCGCAGGGAGCGGACATGGACTACGACTCGTACC
AGCACTATTTCTACGACTATGACTGCGGGGAGGATTTCTACCGCTCCACGGCGCCCAGCG
AGGACATCTGGAAGAAATTCGAGCTGGTGCCATCGCCCCCCACGTCGCCGCCCTGGGGCT
TGGGTCCCGGCGCAGGGGACCCGGCCCCCGGGATTGGTCCCCCGGAGCCGTGGCCCGGAG
GGTGCACCGGAGACGAAGCGGAATCCCGGGGCCACTCGAAAGGCTGGGGCAGGAACTACG
CCTCCATCATACGCCGTGACTGCATGTGGAGCGGCTTCTCGGCCCGGGAACGGCTGGAGA
GAGCTGTGAGCGACCGGCTCGCTCCTGGCGCGCCCCGGGGGAACCCGCCCAAGGCGTCCG
CCGCCCCGGACTGCACTCCCAGCCTCGAAGCCGGCAACCCGGCGCCCGCCGCCCCCTGTC
CGCTGGGCGAACCCAAGACCCAGGCCTGCTCCGGGTCCGAGAGCCCAAGCGACTCGGAGA
ATGAAGAAATTGATGTTGTGACAGTAGAGAAGAGGCAGTCTCTGGGTATTCGGAAGCCGG
TCACCATCACGGTGCGAGCAGACCCCCTGGATCCCTGCATGAAGCATTTCCACATCTCCA
TCCATCAGCAACAGCACAACTATGCTGCCCGTTTTCCTCCAGAAAGCTGCTCCCAAGAAG
AGGCTTCAGAGAGGGGTCCCCAAGAAGAGGTTCTGGAGAGAGATGCTGCAGGGGAAAAGG
AAGATGAGGAGGATGAAGAGATTGTGAGTCCCCCACCTGTAGAAAGTGAGGCTGCCCAGT
CCTGCCACCCCAAACCTGTCAGTTCTGATACTGAGGATGTGACCAAGAGGAAGAATCACA
ACTTCCTGGAGCGCAAGAGGCGGAATGACCTGCGTTCGCGATTCTTGGCGCTGAGGGACC
AGGTGCCCACCCTGGCCAGCTGCTCCAAGGCCCCCAAAGTAGTGATCCTAAGCAAGGCCT
TGGAATACTTGCAAGCCCTGGTGGGGGCTGAGAAGAGGATGGCTACAGAGAAAAGACAGC
TCCGATGCCGGCAGCAGCAGTTGCAGAAAAGAATTGCATACCTCACTGGCTACTAACTGA
CCAAAAAGCCTGACAGTTCTGTCTTACGAAGACACAAGTTTATTTTTTAACCTCCCTCTC
CCCTTTAGTAATTTGCACATTTTGGTTATGGTGGGACAGTCTGGACAGTAGATCCCAGAA
TGCATTGCAGCCGGTGCACACACAATAAAGGCTTGCATTCTTGGAAACCTTGAAACCCAG
CTCTCCCTCTTCCCTGACTCATGGGAGTGCTGTATGTTCTCTGGCGCCTTTGGCTTCCCA
GCAGGCAGCTGACTGAGGAGCCTTGGGGTCTGCCTAGCTCACTAGCTCTGAAGAAAAGGC
TGACAGATGCTATGCAACAGGTGGTGGATGTTGTCAGGGGCTCCAGCCTGCATGAAATCT
CACACTCTGCATGAGCTTTAGGCTAGGAAAGGATGCTCCCAACTGGTGTCTCTGGGGTGA
TGCAAGGACAGCTGGGCCTGGATGCTCTCCCTGAGGCTCCTTTTTCCAGAAGACACACGA
GCTGTCTTGGGTGAAGACAAGCTTGCAGACTTGATCAACATTGACCATTACCTCACTGTC
AGACACTTTACAGTAGCCAAGGAGTTGGAAACCTTTATATATTATGATGTTAGCTGACCC
CCTTCCTCCCACTCCCAATGCTGCGACCCTGGGAACACTTAAAAAGCTTGGCCTCTAGAT
TCTTTGTCTCAGAGCCCTCTGGGCTCTCTCCTCTGAGGGAGGGACCTTTCTTTCCTCACA
AGGGACTTTTTTGTTCCATTATGCCTTGTTATGCAATGGGCTCTACAGCACCCTTTCCCA
CAGGTCAGAAATATTTCCCCAAGACACAGGGAAATCGGTCCTAGCCTGGGGCCTGGGGAT
AGCTTGGAGTCCTGGCCCATGAACTTGATCCCTGCCCAGGTGTTTTCCGAGGGGCACTTG
AGGCCCAGTCTTTTCTCAAGGCAGGTGTAAGACACCTCAGAGGGAGAACTGTACTGCTGC
CTCTTTCCCACCTGCCTCATCTCAATCCTTGAGCGGCAAGTTTGAAGTTCTTCTGGAACC
ATGCAAATCTGTCCTCCTCATGCAATTCCAAGGAGCTTGCTGGCTCTGCAGCCACCCTTG
GGCCCCTTCCAGCCTGCCATGAATCAGATATCTTTCCCAGAATCTGGGCGTTTCTGAAGT
TTTGGGGAGAGCTGTTGGGACTCATCCAGTGCTCCAGAAGGTGGACTTGCTTCTGGTGGG
TTTTAAAGGAGCCTCCAGGAGATATGCTTAGCCAACCATGATGGATTTTACCCCAGCTGG
ACTCGGCAGCTCCAAGTGGAATCCACGTGCAGCTTCTAGTCTGGGAAAGTCACCCAACCT
AGCAGTTGTCATGTGGGTAACCTCAGGCACCTCTAAGCCTGTCCTGGAAGAAGGACCAGC
AGCCCCTCCAGAACTCTGCCCAGGACAGCAGGTGCCTGCTGGCTCTGGGTTTGGAAGTTG
GGGTGGGTAGGGGGTGGTAAGTACTATATATGGCTCTGGAAAACCAGCTGCTACTTCCAA
ATCTATTGTCCATAATGGTTTCTTTCTGAGGTTGCTTCTTGGCCTCAGAGGACCCCAGGG
GATGTTTGGAAATAGCCTCTCTACCCTTCTGGAGCATGGTTTACAAAAGCCAGCTGACTT
CTGGAATTGTCTATGGAGGACAGTTTGGGTGTAGGTTACTGATGTCTCAACTGAATAGCT
TGTGTTTTATAAGCTGCTGTTGGCTATTATGCTGGGGGAGTCTTTTTTTTTTATATTGTA
TTTTTGTATGCCTTTTGCAAAGTGGTGTTAACTGTTTTTGTACAAGGAAAAAAACTCTTG
GGGCAATTTCCTGTTGCAAGGGTCTGATTTATTTTGAAAGGCAAGTTCACCTGAAATTTT
GTATTTAGTTGTGATTACTGATTGCCTGATTTTAAAATGTTGCCTTCTGGGACATCTTCT
AATAAAAGATTTCTCAAACATGTC

Protein Sequence

>4610 : length: 394
MCVCAGCRAAPSRRGAGPLQVAGGWSEGADMDYDSYQHYFYDYDCGEDFYRSTAPSEDIW
KKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASII
RRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGE
PKTQACSGSESPSDSENEEIDVVTVEKRQSLGIRKPVTITVRADPLDPCMKHFHISIHQQ
QHNYAARFPPESCSQEEASERGPQEEVLERDAAGEKEDEEDEEIVSPPPVESEAAQSCHP
KPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYL
QALVGAEKRMATEKRQLRCRQQQLQKRIAYLTGY