ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4609

Name

MYC

Synonym

MRTL|MYCC|bHLHe39|c-Myc;v-myc avian myelocytomatosis viral oncogene homolog;MYC;v-myc avian myelocytomatosis viral oncogene homolog

Definition

avian myelocytomatosis viral oncogene homolog|class E basic helix-loop-helix protein 39|myc proto-oncogene protein|myc-related translation/localization regulatory factor|proto-oncogene c-Myc|transcription factor p64|v-myc myelocytomatosis viral oncogene h

Position

8q24.21

Gene Type

protein-coding

Pathways and Diseases

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

LKB1 signaling events;PID Curated;200061

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

mechanism of gene regulation by peroxisome proliferators via ppara;PID BioCarta;100066

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

telomeres telomerase cellular aging and immortality;PID BioCarta;100021

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

C-MYC pathway;PID Curated;200093

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

p38 mapk signaling pathway;PID BioCarta;100085

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

erk1/erk2 mapk signaling pathway;PID BioCarta;100170

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

cadmium induces dna synthesis and proliferation in macrophages;PID BioCarta;100209

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Kidney failure;FunDO

Disease

Epstein-Barr virus infection;FunDO

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

kidney transplant;GAD

Disease

breast cancer;GAD

Disease

Cancer;FunDO

Disease

Oral cancer;FunDO

Disease

Leukoencephalopathy;FunDO

Disease

Werner syndrome;FunDO

Disease

colorectal carcinomas;GAD

Disease

Multiple myeloma;KEGG DISEASE;H00010

Disease

Acute lymphoblastic leukemia (ALL) (Precursor T lymphoblastic leukemia);KEGG DISEASE;H00002

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Rheumatoid arthritis;FunDO

Disease

Kaposi's sarcoma;KEGG DISEASE;H00041

Disease

Choriocarcinoma;KEGG DISEASE;H00028

Disease

Viral infections;KEGG DISEASE

Disease

hepatocellular carcinomas;GAD

Disease

Acute lymphoblastic leukemia (ALL) (Precursor B lymphoblastic leukemia);KEGG DISEASE;H00001

Disease

Urinary bladder cancer;NHGRI

Disease

Breast cancer;KEGG DISEASE;H00031

Disease

Synovitis;FunDO

Disease

Ovarian cancer;KEGG DISEASE;H00027

Disease

Adenovirus infection;FunDO

Disease

Penile cancer;KEGG DISEASE;H00025

Disease

CANCER;GAD

Disease

Oral cancer;KEGG DISEASE;H00016

Disease

Infections caused by dsDNA viruses;KEGG DISEASE

Disease

Laryngeal cancer;KEGG DISEASE;H00055

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

urinary bladder cancer;GAD

Disease

Cancers;KEGG DISEASE

Disease

Small cell lung cancer;KEGG DISEASE;H00013

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Burkitt lymphoma;KEGG DISEASE;H00008

Disease

Osteosarcoma;KEGG DISEASE;H00036

Disease

Hemophilia;FunDO

Disease

Head and neck cancers;KEGG DISEASE

Disease

Ovarian cancer;NHGRI

Disease

Burkitt lymphoma;OMIM

Disease

RENAL;GAD

External Links

Links to cell senescence gene database

4609

Links to epithelial mesenchymal transition gene database

4609

Links to ovarian cancer gene database

4609

Links to endometrial cancer gene database

4609

Links to iHOP

4609

Sequence Information

Nucleotide Sequence

>4609 : length: 2379
GACCCCCGAGCTGTGCTGCTCGCGGCCGCCACCGCCGGGCCCCGGCCGTCCCTGGCTCCC
CTCCTGCCTCGAGAAGGGCAGGGCTTCTCAGAGGCTTGGCGGGAAAAAGAACGGAGGGAG
GGATCGCGCTGAGTATAAAAGCCGGTTTTCGGGGCTTTATCTAACTCGCTGTAGTAATTC
CAGCGAGAGGCAGAGGGAGCGAGCGGGCGGCCGGCTAGGGTGGAAGAGCCGGGCGAGCAG
AGCTGCGCTGCGGGCGTCCTGGGAAGGGAGATCCGGAGCGAATAGGGGGCTTCGCCTCTG
GCCCAGCCCTCCCGCTGATCCCCCAGCCAGCGGTCCGCAACCCTTGCCGCATCCACGAAA
CTTTGCCCATAGCAGCGGGCGGGCACTTTGCACTGGAACTTACAACACCCGAGCAAGGAC
GCGACTCTCCCGACGCGGGGAGGCTATTCTGCCCATTTGGGGACACTTCCCCGCCGCTGC
CAGGACCCGCTTCTCTGAAAGGCTCTCCTTGCAGCTGCTTAGACGCTGGATTTTTTTCGG
GTAGTGGAAAACCAGCAGCCTCCCGCGACGATGCCCCTCAACGTTAGCTTCACCAACAGG
AACTATGACCTCGACTACGACTCGGTGCAGCCGTATTTCTACTGCGACGAGGAGGAGAAC
TTCTACCAGCAGCAGCAGCAGAGCGAGCTGCAGCCCCCGGCGCCCAGCGAGGATATCTGG
AAGAAATTCGAGCTGCTGCCCACCCCGCCCCTGTCCCCTAGCCGCCGCTCCGGGCTCTGC
TCGCCCTCCTACGTTGCGGTCACACCCTTCTCCCTTCGGGGAGACAACGACGGCGGTGGC
GGGAGCTTCTCCACGGCCGACCAGCTGGAGATGGTGACCGAGCTGCTGGGAGGAGACATG
GTGAACCAGAGTTTCATCTGCGACCCGGACGACGAGACCTTCATCAAAAACATCATCATC
CAGGACTGTATGTGGAGCGGCTTCTCGGCCGCCGCCAAGCTCGTCTCAGAGAAGCTGGCC
TCCTACCAGGCTGCGCGCAAAGACAGCGGCAGCCCGAACCCCGCCCGCGGCCACAGCGTC
TGCTCCACCTCCAGCTTGTACCTGCAGGATCTGAGCGCCGCCGCCTCAGAGTGCATCGAC
CCCTCGGTGGTCTTCCCCTACCCTCTCAACGACAGCAGCTCGCCCAAGTCCTGCGCCTCG
CAAGACTCCAGCGCCTTCTCTCCGTCCTCGGATTCTCTGCTCTCCTCGACGGAGTCCTCC
CCGCAGGGCAGCCCCGAGCCCCTGGTGCTCCATGAGGAGACACCGCCCACCACCAGCAGC
GACTCTGAGGAGGAACAAGAAGATGAGGAAGAAATCGATGTTGTTTCTGTGGAAAAGAGG
CAGGCTCCTGGCAAAAGGTCAGAGTCTGGATCACCTTCTGCTGGAGGCCACAGCAAACCT
CCTCACAGCCCACTGGTCCTCAAGAGGTGCCACGTCTCCACACATCAGCACAACTACGCA
GCGCCTCCCTCCACTCGGAAGGACTATCCTGCTGCCAAGAGGGTCAAGTTGGACAGTGTC
AGAGTCCTGAGACAGATCAGCAACAACCGAAAATGCACCAGCCCCAGGTCCTCGGACACC
GAGGAGAATGTCAAGAGGCGAACACACAACGTCTTGGAGCGCCAGAGGAGGAACGAGCTA
AAACGGAGCTTTTTTGCCCTGCGTGACCAGATCCCGGAGTTGGAAAACAATGAAAAGGCC
CCCAAGGTAGTTATCCTTAAAAAAGCCACAGCATACATCCTGTCCGTCCAAGCAGAGGAG
CAAAAGCTCATTTCTGAAGAGGACTTGTTGCGGAAACGACGAGAACAGTTGAAACACAAA
CTTGAACAGCTACGGAACTCTTGTGCGTAAGGAAAAGTAAGGAAAACGATTCCTTCTAAC
AGAAATGTCCTGAGCAATCACCTATGAACTTGTTTCAAATGCATGATCAAATGCAACCTC
ACAACCTTGGCTGAGTCTTGAGACTGAAAGATTTAGCCATAATGTAAACTGCCTCAAATT
GGACTTTGGGCATAAAAGAACTTTTTTATGCTTACCATCTTTTTTTTTTCTTTAACAGAT
TTGTATTTAAGAATTGTTTTTAAAAAATTTTAAGATTTACACAATGTTTCTCTGTAAATA
TTGCCATTAAATGTAAATAACTTTAATAAAACGTTTATAGCAGTTACACAGAATTTCAAT
CCTAGTATATAGTACCTAGTATTATAGGTACTATAAACCCTAATTTTTTTTATTTAAGTA
CATTTTGCTTTTTAAAGTTGATTTTTTTCTATTGTTTTTAGAAAAAATAAAATAACTGGC
AAATATATCATTGAGCCAAATCTTAAAAAAAAAAAAAAA

Protein Sequence

>4609 : length: 454
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA