ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4602

Name

MYB

Synonym

Cmyb|c-myb|c-myb_CDS|efg;v-myb avian myeloblastosis viral oncogene homolog;MYB;v-myb avian myeloblastosis viral oncogene homolog

Definition

c-myb protein (140 AA)|c-myb10A_CDS|c-myb13A_CDS|c-myb14A_CDS|c-myb8B_CDS|proto-oncogene c-Myb|transcriptional activator Myb

Position

6q22-q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Disease

Bone marrow disease;FunDO

Disease

Myeloproliferative disease;FunDO

Disease

hematological parameters;GAD

Disease

Beta thalassemia/hemoglobin E disease;GAD

Disease

HEMATOLOGICAL;GAD

Disease

T-cell acute lymphoblastic leukemia;OMIM

Disease

Leukemia;FunDO

Disease

Cancer;FunDO

Disease

other erythrocyte phenotypes;GAD

Disease

mean corpuscular hemoglobin;GAD

Disease

mean corpuscular volume;GAD

Disease

hematocrit;GAD

External Links

Links to cell senescence gene database

4602

Links to epithelial mesenchymal transition gene database

4602

Links to ovarian cancer gene database

4602

Links to endometrial cancer gene database

4602

Links to iHOP

4602

Sequence Information

Nucleotide Sequence

>4602 : length: 3826
CGGGACTGGGCGCGGGTCGGCGCCGCCGCGACCCGGGAGCGGGGTTTGCTCAGGAAAAGG
CGCCGTCGCGGCCCCCGGCCACCCCTCCCTGGCCCCGGGCTCCCTGCCCGCGCGCCTCCC
GGGCCTCGCGGCGCGCTAGGCGCACCGCGGCGGCGCGAGCGCCGAATGGGAGCGGCGACC
CGGCCAGCCCGGCAGCCCCGCGGGCGGCAGCCAGGGCGACCGCGGAGGCGGCGGGCAGGG
CGCGTGCGCACTGCAGGGGCGCCAGATTTGGCGGGAGGGGGAGTGTCCAAAGCTCTTTGT
TTGATGGCATCTCTGTTTACAGAGTTTACACTTTAATATCAACCTGTTTCCTCCTCCTCC
TTCTCCTCCTCCTCCGTGACCTCCTCCTCCTCTTTCTCCTGAGAAACTTCGCCCCAGCGG
TGCGGAGCGCCGCTGCGCAGCCGGGGAGGGACGCAGGCAGGCGGCGGGCAGCGGGAGGCG
GCAGCCCGGTGCGGTCCCCGCGGCTCTCGGCGGAGCCCCGCGCCCGCCGCGCCATGGCCC
GAAGACCCCGGCACAGCATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTG
ACCATGACTATGATGGGCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGT
GGACCCGGGAAGAGGATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACAGATGACT
GGAAAGTTATTGCCAATTATCTCCCGAATCGAACAGATGTGCAGTGCCAGCACCGATGGC
AGAAAGTACTAAACCCTGAGCTCATCAAGGGTCCTTGGACCAAAGAAGAAGATCAGAGAG
TGATAGAGCTTGTACAGAAATACGGTCCGAAACGTTGGTCTGTTATTGCCAAGCACTTAA
AGGGGAGAATTGGAAAACAATGTAGGGAGAGGTGGCATAACCACTTGAATCCAGAAGTTA
AGAAAACCTCCTGGACAGAAGAGGAAGACAGAATTATTTACCAGGCACACAAGAGACTGG
GGAACAGATGGGCAGAAATCGCAAAGCTACTGCCTGGACGAACTGATAATGCTATCAAGA
ACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGAAGGTTATCTGCAGGAGTCTT
CAAAAGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAAGAACAGTCATTTGATGGGTT
TTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGGCCAGCCCACTGTTAACAACG
ACTATTCCTATTACCACATTTCTGAAGCACAAAATGTCTCCAGTCATGTTCCATACCCTG
TAGCGTTACATGTAAATATAGTCAATGTCCCTCAGCCAGCTGCCGCAGCCATTCAGAGAC
ACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTGCTCCTAA
TGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCATTATGTGGGCCATTACTGA
ATTCTGACATCTTTAGCGACTGGGCAGCCAACTGGGATGGCTCCTTGTGCTTTGCAACAT
ACATAGTTAACCAACAAAGACAATAAAAGAGAAGTGATGCCCAACACAGAACCACACATG
CAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCACACCAGACCTCATGGAGACAG
TGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCTCTGCCAGCGGATCCTGG
CTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATCGTCCACCAGGGCACCAT
TCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTCCAATTTATAGATTCTTT
CTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCCAC
CCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTGAA
AACTCAAAAGGAAAATACTGTATAGGACCTCTTCTGACATCCCCAGGAATATTATATGAT
TAGAAGCCAAGGGATGATTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCT
CCAAGAACTCCTACACCATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCC
CTGAAGATGCTACCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAA
CAGGAATCTGATGAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTG
AAGAAAATCAAACAAGAGGTGGAATCTCCAACTGATAAATCAGGAAACTTCTTCTGCTCA
CACCACTGGGAAGGGGACAGTCTGAATACCCAACTGTTCACGCAGACCTCGCCTGTGGCA
GATGCACCGAATATTCTTACAAGCTCCGTTTTAATGGCACCAGCATCAGAAGATGAAGAC
AATGTTCTCAAAGCATTTACAGTACCTAAAAACAGGTCCCTGGCGAGCCCCTTGCAGCCT
TGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGACATCTTCC
AGTCAAGCTCGTAAATACGTGAATGCATTCTCAGCCCGGACGCTGGTCATGTGAGACATT
TCCAGAAAAGCATTATGGTTTTCAGAACACTTCAAGTTGACTTGGGATATATCATTCCTC
AACATGAAACTTTTCATGAATGGGAGAAGAACCTATTTTTGTTGTGGTACAACAGTTGAG
AGCAGCACCAAGTGCATTTAGTTGAATGAAGTCTTCTTGGATTTCACCCAACTAAAAGGA
TTTTTAAAAATAAATAACAGTCTTACCTAAATTATTAGGTAATGAATTGTAGCCAGTTGT
TAATATCTTAATGCAGATTTTTTTAAAAAAAACATAAAATGATTTATCTGTATTTTAAAG
GATCCAACAGATCAGTATTTTTTCCTGTGATGGGTTTTTTGAAATTTGACACATTAAAAG
GTACTCCAGTATTTCACTTTTCTCGATCACTAAACATATGCATATATTTTTAAAAATCAG
TAAAAGCATTACTCTAAGTGTAGACTTAATACCATGTGACATTTAATCCAGATTGTAAAT
GCTCATTTATGGTTAATGACATTGAAGGTACATTTATTGTACCAAACCATTTTATGAGTT
TTCTGTTAGCTTGCTTTAAAAATTATTACTGTAAGAAATAGTTTTATAAAAAATTATATT
TTTATTCAGTAATTTAATTTTGTAAATGCCAAATGAAAAACGTTTTTTGCTGCTATGGTC
TTAGCCTGTAGACATGCTGCTAGTATCAGAGGGGCAGTAGAGCTTGGACAGAAAGAAAAG
AAACTTGGTGTTAGGTAATTGACTATGCACTAGTATTTCAGACTTTTTAATTTTATATAT
ATATACATTTTTTTTCCTTCTGCAATACATTTGAAAACTTGTTTGGGAGACTCTGCATTT
TTTATTGTGGTTTTTTTGTTATTGTTGGTTTATACAAGCATGCGTTGCACTTCTTTTTTG
GGAGATGTGTGTTGTTGATGTTCTATGTTTTGTTTTGAGTGTAGCCTGACTGTTTTATAA
TTTGGGAGTTCTGCATTTGATCCGCATCCCCTGTGGTTTCTAAGTGTATGGTCTCAGAAC
TGTTGCATGGATCCTGTGTTTGCAACTGGGGAGACAGAAACTGTGGTTGATAGCCAGTCA
CTGCCTTAAGAACATTTGATGCAAGATGGCCAGCACTGAACTTTTGAGATATGACGGTGT
ACTTACTGCCTTGTAGCAAAATAAAGATGTGCCCTTATTTTACCTA

Protein Sequence

>4602 : length: 761
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTV
NNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADF
SPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSESSLDPPKVLPPARHSTIPLVIL
RKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSL
TSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEI
KYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGN
FFCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLAS
PLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM