ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4585

Name

MUC4

Synonym

ASGP|HSA276359|MUC-4;mucin 4, cell surface associated;MUC4;mucin 4, cell surface associated

Definition

ascites sialoglycoprotein|mucin 4, tracheobronchial|mucin-4|pancreatic adenocarcinoma mucin|testis mucin|tracheobronchial mucin

Position

3q29

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4585

Links to epithelial mesenchymal transition gene database

4585

Links to ovarian cancer gene database

4585

Links to endometrial cancer gene database

4585

Links to iHOP

4585

Sequence Information

Nucleotide Sequence

>4585 : length: 16819
CTCTTTTGTCCTCTTCCCAGGTTCCCTGGCCCCTTCGGAGAAACGCACTTGGTTCGGGCC
AGCCGCCTGAGGGGACGGGCTCACGTCTGCTCCTCACACTGCAGCTGCTGGGCCGTGGAG
CTTCCCCAGGGAGCCAGGGGGACTTTTGCCGCAGCCATGAAGGGGGCACGCTGGAGGAGG
GTCCCCTGGGTGTCCCTGAGCTGCCTGTGTCTCTGCCTCCTTCCGCATGTGGTCCCAGGA
ACCACAGAGGACACATTAATAACTGGAAGTAAAACTGCTGCCCCAGTCACCTCAACAGGC
TCAACAACAGCGACACTAGAGGGACAATCAACTGCAGCTTCTTCAAGGACCTCTAATCAG
GACATATCAGCTTCATCTCAGAACCACCAGACTAAGAGCACGGAGACCACCAGCAAAGCT
CAAACCGACACCCTCACGCAGATGATGACATCAACTCTTTTTTCTTCCCCAAGTGTACAC
AATGTGATGGAGACAGCTCCTCCAGATGAAATGACCACATCATTTCCCTCCAGTGTCACC
AACACACTCATGATGACATCAAAGACTATAACAATGACAACCTCCACAGACTCCACTCTT
GGAAACACAGAAGAGACATCAACAGCAGGAACTGAAAGTTCTACCCCAGTGACCTCAGCA
GTCTCAATAACAGCTGGACAGGAAGGACAATCACGAACAACTTCCTGGAGGACCTCTATC
CAAGACACATCAGCTTCTTCTCAGAACCACTGGACTCGGAGCACGCAGACCACCAGGGAA
TCTCAAACCAGCACCCTAACACACAGAACCACTTCAACTCCTTCTTTCTCTCCAAGTGTA
CACAATGTGACAGGGACTGTTTCTCAGAAGACATCTCCTTCAGGTGAAACAGCTACCTCA
TCCCTCTGTAGTGTCACAAACACATCCATGATGACATCAGAGAAGATAACAGTGACAACC
TCCACAGGCTCCACTCTTGGAAACCCAGGGGAGACATCATCAGTACCTGTTACTGGAAGT
CTTATGCCAGTCACCTCAGCAGCCTTAGTAACATTTGATCCAGAAGGACAATCACCAGCA
ACTTTCTCAAGGACTTCTACTCAGGACACAACAGCTTTTTCTAAGAACCACCAGACTCAG
AGCGTGGAGACCACCAGAGTATCTCAAATCAACACCCTCAACACCCTCACACCGGTTACA
ACATCAACTGTTTTATCCTCACCAAGTGGATTCAACCCAAGTGGAACAGTTTCTCAGGAG
ACATTCCCTTCTGGTGAAACAACCACCTCATCCCCTTCCAGTGTCAGCAATACATTCCTG
GTAACATCAAAGGTGTTCAGAATGCCAACCTCCAGAGACTCTACTCTTGGAAACACAGAG
GAGACATCACTATCTGTAAGTGGAACCATTTCTGCAATCACTTCCAAAGTTTCAACCATA
TGGTGGTCAGACACTCTGTCAACAGCACTCTCCCCCAGTTCTCTACCTCCAAAAATATCC
ACAGCTTTCCACACCCAGCAGAGTGAAGGTGCAGAGACCACAGGACGGCCTCATGAGAGG
AGCTCATTCTCTCCAGGTGTGTCTCAAGAAATATTTACTCTACATGAAACAACAACATGG
CCTTCCTCATTCTCCAGCAAAGGCCACACAACTTGGTCACAAACAGAACTGCCCTCAACA
TCAACAGGTGCTGCCACTAGGCTTGTCACAGGAAATCCATCTACAGGGACAGCTGGCACT
ATTCCAAGGGTCCCCTCTAAGGTCTCAGCAATAGGGGAACCAGGAGAGCCCACCACATAC
TCCTCCCACAGCACAACTCTCCCAAAAACAACAGGGGCAGGCGCCCAGACACAATGGACA
CAAGAAACGGGGACCACTGGAGAGGCTCTTCTCAGCAGCCCAAGCTACAGTGTGACTCAG
ATGATAAAAACGGCCACATCCCCATCTTCTTCACCTATGCTGGATAGACACACATCCCAA
CAAATTACAACGGCACCATCAACAAATCATTCAACAATACATTCCACAAGCACCTCTCCT
CAGGAATCACCAGCTGTTTCCCAAAGGGGTCACACTCAAGCCCCGCAGACCACACAAGAA
TCACAAACCACGAGGTCCGTCTCCCCCATGACTGACACCAAGACAGTCACCACCCCAGGT
TCTTCCTTCACAGCCAGTGGGCACTCGCCCTCAGAAATTGTTCCTCAGGACGCACCCACC
ATAAGTGCAGCAACAACCTTTGCCCCAGCTCCCACCGGGGATGGTCACACAACCCAGGCC
CCGACCACAGCACTGCAGGCAGCACCCAGCAGCCATGATGCCACCCTGGGGCCCTCAGGA
GGCACGTCACTTTCCAAAACAGGTGCCCTTACTCTGGCCAACTCTGTAGTGTCAACACCA
GGGGGCCCAGAAGGACAATGGACATCAGCCTCTGCCAGCACCTCACCTGACACAGCAGCA
GCCATGACCCATACCCACCAGGCTGAGAGCACAGAGGCCTCTGGACAAACACAGACCAGC
GAACCGGCCTCCTCAGGGTCACGAACCACCTCAGCGGGCACAGCTACCCCTTCCTCATCC
GGGGCGAGTGGCACAACACCTTCAGGAAGCGAAGGAATATCCACCTCAGGAGAGACGACA
AGGTTTTCATCAAACCCCTCCAGGGACAGTCACACAACCCAGTCAACAACCGAATTGCTG
TCCGCCTCAGCCAGTCATGGTGCCATCCCAGTAAGCACAGGAATGGCGTCTTCGATCGTC
CCCGGCACCTTTCATCCCACCCTCTCTGAGGCCTCCACTGCAGGGAGACCGACAGGACAG
TCAAGCCCAACTTCTCCCAGTGCCTCTCCTCAGGAGACAGCCGCCATTTCCCGGATGGCC
CAGACTCAGAGGACAAGAACCAGCAGAGGGTCTGACACTATCAGCCTGGCGTCCCAGGCA
ACCGACACCTTCTCAACAGTCCCACCCACACCTCCATCGATCACATCCACTGGGCTTACA
TCTCCACAAACCGAGACCCACACTCTGTCACCTTCAGGGTCTGGTAAAACCTTCACCACG
GCCCTCATCAGCAACGCCACCCCTCTTCCTGTCACCTACGCTTCCTCGGCATCCACAGGT
CACACCACCCCTCTTCATGTCACCGATGCTTCCTCAGTATCCACAGGTCACGCCACCCCT
CTTCCTGTCACCAGCCCTTCCTCAGTATCCACAGGTCACACCACCCCTCTTCCTGTCACC
GACACTTCCTCAGAATCCACAGGTCACGTCACCCCTCTTCCTGTCACCAGCTTTTCCTCA
GCATCCACAGGTGACAGCACCCCTCTTCCTGTCACTGACACTTCCTCAGCATCCACAGGT
CACGTCACCCCTCTTCCTGTCACCAGCCTTTCCTCAGCATCCACAGGTGACACCACCCCT
CTTCCTGTCACTGACACTTCCTCAGCATCCACAGGTCACGCCACCTCTCTTCCTGTCACC
GACACTTCCTCAGTATCCACAGGTCACACCACCCCTCTTCCTGTCACCGACACTTCCTCA
GCATCCACAGGTCACGCCACCTCTCTTCCTGTCACCGACACTTCCTCAGTATCCACAGGT
CACACCACCCCTCTTCATGTCACTGATGCTTCCTCAGCATCCACAGGTCAGGCCACCCCT
CTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACGCCTCTTCCTGTCACT
AGCCCTTCCTCAGCATCCACAGGTCACGCCACCCCTCTTCTTGTCACCGACACTTCCTCA
GCATCCACAGGACACGCCACCCCTCTTCCTGTCACCGACGCTTCCTCAGTGTCCACAGAT
CACGCCACCTCTCTTCCTGTAACCATCCCTTCCGCAGCATCCACAGGTCACACCACCCCT
CTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTCAGGCCACCTCTCTTCTTGTCACC
GACACTTCCTCAGTATCCACAGGTGACACCACGCCTCTTCCTGTCACTAGCACTTCCTCA
GCATCCACAGGTCACGTCACTCCTCTTCATGTCACCAGCCCTTCCTCAGCATCCACAGGT
CACGCCACCCCTCTTCCTGTCACCAGCCTTTCCTCAGCATCCACAGGTGACACCATGCCT
CTTCCTGTCACTAGCCCTTCCTCAGCATCCACAGGTGACACCACCCCTCTTCCTGTCACC
GACGCTTCCTCAGTATCCACAGGTCACACCACCCCTCTTCATGTCACTGATGCTTCCTCA
GCATCCACAGGTCAGGCCACCCCTCTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGT
GACACCACGCCTCTTCCTGTCACTAGCCCTTCCTCAGCATCCACAGGTCACGCCACCCCT
CTTCTTGTCACCGACACTTCCTCAGCATCCACAGGACACGCCACCCCTCTTCCTGTCACC
GACGCTTCCTCAGTGTCCACAGATCACGCCACCTCTCTTCCTGTAACCATCCCTTCCGCA
GCATCCACAGGTCACACCACCCCTCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGT
CAGGCCACCTCTCTTCTTGTCACCGACACTTCCTCAGTATCCACAGGTGACACCACGCCT
CTTCCTGTCACTAGCACTTCCTCAGCATCCACAGGTCACGTCACTCCTCTTCATGTCACC
AGCCCTTCCTCAGCATCCACAGGTCACGCCACCCCTCTTCCTGTCACCAGCCTTTCCTCA
GCATCCACAGGTGACACCATGCCTCTTCCTGTCACTAGCCCTTCCTCAGCATCCACAGGT
GACACCACCCCTCTTCCTGTCACCGACGCTTCCTCAGTATCCACAGGTCACACCACCCCT
CTTCCTGTCACCAGCCCTTCCTCAGCATCTACAGGTCACACCACCCCTCTTCCTGTCACC
GACACTTCCTCAGCATCCAAAGGTGACACCACCCCTCTTCCTGTCACCAGCCCTTCCTCA
GCATCTACAGGTCACACCACCCCTCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGT
GACACCACCCCTCTTCCTGTCACCAATGCTTCCTCATTATCCACAGGTCACGCCACCCCT
CTTCATGTCACCAGCCCTTCCTCAGCATCCACAGGTCACGCCACCCCTCTTCCTGTCACC
AGCACTTCCTCAGCATCCACCGGTCACGCCACCCCTCTTCCTGTCACCGGCCTTTCCTCA
GCTACCACAGATGACACCACCCGTCTTCCTGTCACCGACGTTTCCTCGGCATCCACAGGT
CAGGCCACCCCTCTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACGCCT
CTTCCTGTCACTAGCCCTTCCTCAGCATCCACAGGTCACGCCAGCCCTCTTCTTGTCACT
GACGCTTCCTCAGCATCCACAGGTCAGGCCACCCCTCTTCCTGTCACCGACACTTCCTCA
GTATCCACAGCTCACGCCACCCCACTTCCTGTCACCGGCCTTTCTTCAGCTTCCACAGAT
GACACCACCCGTCTTCCTGTCACCGACGTTTCCTCGGCATCCACAGGTCAGGCCATCCCT
CTTCCTGTCACCAGCCCTTCCTCAGCATCCACAGGTGACACCACCCCTCTTCCTGTCACC
GACGCTTCCTCAGCATCCACAGGTGACACCACCTCTCTTCCTGTCACCATCCCTTCCTCA
GCATCTTCAGGTCACACCACCTCTCTTCCTGTCACCGACGCTTCCTCAGTGTCCACAGGT
CACGCCACCTCTCTTCTTGTCACCGACGCTTCCTCAGTATCCACAGGTGACACCACCCCT
CTTCCTGTCACCGACACTAACTCAGCATCCACAGGTGACACCACCCCTCTTCATGTCACC
GACGCTTCCTCAGTATCCACAGGTCACGCCACCTCTCTTCCTGTCACCAGCCTTTCCTCA
GCATCCACAGGTGACACCACGCCTCTTCCTGTCACTAGCCCTTCCTCAGCATCCTCAGGT
CACACCACCCCTCTTCCTGTCACCGACGCTTCCTCAGTACCCACAGGTCACGCCACCTCT
CTTCCTGTCACCGACGCTTCCTCAGTGTCCACAGGTCACGCCACCCCTCTTCCTGTCACC
GACGCTTCCTCAGTGTCCACAGGTCATGCCACCCCTCTTCCGGTCACCGACACTTCCTCA
GTATCTACAGGACAGGCCACCCCTCTTCCTGTCACCAGCCTTTCCTCAGCATCCACTGGT
GACACCACGCCGCTTCCTGTCACCGATACTTCCTCAGCATCCACAGGTCAGGACACCCCT
CTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACGCCTCTTCCTGTCACT
AACCCTTCCTCAGCATCCACAGGTCACGCCACCCCTCTTCTTGTCACCGACGCTTCCTCA
ATATCCACAGGTCACGCCACCTCTCTTCTTGTCACCGACGCTTCCTCAGTATCCACAGGT
CACGCCACCGCTCTTCATGACACCGATGCTTCCTCATTATCCACAGGGGACACCACCCCT
CTTCCTGTCACCAGCCCTTCCTCAACATCCACAGGTGACACCACCCCTCTTCCTGTCACC
GAAACTTCCTCAGTATCCACAGGTCACGCCACCTCTCTTCCTGTCACCGACACTTCCTCA
GCATCCACAGGTCACGCCACCTCTCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGT
CACGCCACCCCTCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTCAGGCCACCCCT
CTTCCTGTCACCAGCCCTTCCTCAGCATCCACAGGTCACGCCATCCCTCTTCTTGTCACC
GACACTTCCTCAGCATCCACAGGACAGGCCACCCCTCTTCCTGTCACCAGCCTTTCCTCA
GCATCCACAGGTGACACCACCCCTCTTCCTGTCACCGACGCTTCCTCAGTGTCCACAGGT
CACGCCACCTCTCTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACTCCT
CTTCCTGTCACTAGCCCTTCCTCAGCATCCACAGGTCACGCCACCCCTCTTCATGTCACC
GACGCTTCCTCAGCATCCACAGGTCACGCCACCCCTCTTCCTGTCACCAGCCTTTCCTCA
GCATCCACAGGTGACACCACGCCTCTTCCTGTCACTAGCCCTTCCTCAGCATCCACAGGT
CACGCCACCCCTCTTCATGTCACCGACGCTTCCTCAGTATCCACAGGTGACACCACCCCT
CTTCCTGTCACCAGCTCTTCCTCAGCATCCTCAGGTCACACCACCCCTCTTCCTGTCACC
GACGCTTCCTCAGCATCCACAGGTGACACCACCCCTCTTCCTGTCACCGACACTTCCTCA
GCATCCACAGGTCACGCCACCCATCTTCCTGTCACCGGCCTTTCCTCAGCTTCCACAGGT
GACACCACCCGTCTTCCTGTCACCAACGTTTCCTCGGCATCCACAGGTCATGCCACCCCT
CTTCCTGTCACCAGCACTTCCTCAGCATCCACAGGTGACACCACCCCTCTTCCTGGCACC
GACACTTCCTCAGTATCCACAGGTCACACCACCCCTCTTCTTGTCACCGACGCTTCGTCA
GTATCCACAGGTGACACCACCCGTCTTCCTGTCACCAGCCCTTCCTCAGCATCTACAGGT
CACACCACCCCTCTACCTGTCACCGACACTCCCTCAGCATCCACAGGTGACACCACCCCT
CTTCCTGTCACCAATGCTTCCTCATTATCCACACGTCACGCCACCTCTCTTCATGTCACC
AGCCCTTCCTCAGCATCCACAGGTCACGCCACCTCTCTTCCTGTCACCGACACTTCCGCA
GCATCCACAGGTCACGCCACCCCTCTTCCTGTCACCAGCACTTCCTCAGCATCCACAGGT
GACACCACCCCTCTTCCTGTCACCGACACTTACTCAGCATCCACAGGTCAGGCCACCCCT
CTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACGCCTCTTCCTGTCACT
AGCCCTTCCTCAGCATCCACAGGTCACGCCACTCCTCTTCTTGTCACCGACGCTTCCTCA
GCATCCACAGGTCAGGCCACCCCTCTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGT
GACACCACGCCTCTTCCTGTCACTAGCCCTTCCTCAGCATCCACCGGTCATGCCACCTCT
CTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTGACACCACCTCTCTTCCTGTCACC
GACACTTCCTCAGCATACACAGGTGACACCACCTCTCTTCCTGTCACCGACACTTCCTCA
TCATCCACAGGTGACACCACCCCTCTTCTTGTCACCGAGACTTCCTCAGTATCCACAGGT
GACACCACCCCTCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTCACGCCACCCCT
CTTCCTGTCACCAACACTTCCTCAGTATCCACAGGTCACGCCACCCCTCTTCATGTCACC
AGCCCTTCCTCAGCATCCACAGGTCACACCACCCCTCTTCCTGTCACCGACGCTTCGTCA
GTGTCCACAGGTCACGCCACCTCTCTTCCTGTCACCGACGCTTCCTCAGTGTTCACAGGT
CATGCCACCTCTCTTCCTGTCACCATCCCTTCCTCAGCATCCTCAGGTCACACCACCCCT
CTTCCTGTCACCGACGCTTCCTCAGTGTCCACAGGTCACGCCACCTCTCTTCCTGTCACC
GACGCTTCCTCAGTGTCCACAGGTCATGCCACCCCTCTTCCTGTCACCGACGCTTCCTCA
GTGTCCACAGGTCACGCTACCCCTCTTCCTCTCACCAGCCTTTCCTCAGTATCCACAGGT
GACACCACGCCTCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTCAGGCCACCCCT
CTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACCCCTCTTCCTGTCACC
GACACTTCCTCAGCATCCACAGGTCACGCCACCTCTCTTCCTGTCACCGACACTTCCTCA
GCATCCACAGGTCACGCCACCCCTCTTCCTGACACCGACACTTCCTCAGCATCCACAGGT
CACGCCACCCTTCTTCCTGTCACCGACACTTCCTCAGCATCCATAGGTCACGCCACCTCT
CTTCCTGTCACCGACACTTCCTCAATATCCACAGGTCACGCCACCCCTCTTCATGTCACC
AGCCCTTCCTCAGCATCCACCGGTCACGCCACCCCGCTTCCTGTCACCGACACTTCCTCA
GCATCCACAGGTCACGCCAACCCTCTTCATGTCACCAGCCCTTCCTCAGCATCCACCGGT
CACGCCACCCCGCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTCACGCCACCCCT
CTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACGCCTCTTCCTGTCACT
AGCCCTTCCTCAGCATCCACAGGTCACACCACCCCTCTTCCTGTCACCGACACTTCCTCA
GCATCCACAGGTCAGGCCACCGCTCTTCCTGTCACCAGCACTTCCTCAGCATCCACAGGT
GACACCACCCCTCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTCAGGCCACCCCT
CTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACGCCTCTTCCTGTCACT
AGCCCTTCCTCAGCATCCACAGGTCACGCCACTCCTCTTCTTGTCACCGACGCTTCCTCA
GCATCCACAGGTCAGGCCACCCCTCTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGT
GACACCACGCCTCTTCCTGTCACTAGCCCTTCCTCAGCATCCACCGGTCATGCCACCTCT
CTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTGACACCACCTCTCTTCCTGTCACC
GACACTTCCTCAGCATACACAGGTGACACCACCTCTCTTCCTGTCACCGACACTTCCTCA
TCATCCACAGGTGACACCACCCCTCTTCTTGTCACCGAGACTTCCTCAGTATCCACAGGT
CACGCCACTCCTCTTCTTGTCACCGACGCTTCCTCAGCATCCACAGGTCACGCCACCCCT
CTTCATGTCACCAGCCCTTCCTCAGCATCCACAGGTGACACCACCCCTGTGCCTGTCACC
GACACTTCCTCAGTATCCACAGGTCACGCCACCCCTCTTCCTGTCACCGGCCTTTCCTCA
GCTTCCACAGGTGACACCACCCGTCTTCCTGTCACCGACATTTCCTCGGCATCCACAGGT
CAGGCCACCCCTCTTCCTGTCACCAACACTTCCTCAGTATCCACAGGTGACACCATGCCT
CTTCCTGTCACTAGCCCTTCCTCAGCATCCACAGGTCACGCCACCCCTCTTCCTGTCACC
AGCACTTCCTCAGCATCCACCGGTCACGCCACCCCTGTTCCTGTCACCAGCACTTCCTCA
GCATCTACAGGTCACACCACCCCTCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGT
GACACCACCCCTCTTCCTGTCACCAGCCCTTCCTCAGCATCTACAGGTCACACCACCCCT
CTTCATGTCACCATCCCTTCCTCAGCATCCACAGGTGACACCAGCACTCTTCCTGTCACC
GGCGCTTCCTCAGCATCCACCGGTCACGCCACCCCTCTTCCTGTCACCGACACTTCCTCA
GTATCCACCGGTCACGCCACGCCTCTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGT
GACACCACCCCTCTTCCTGTCACCGACGCTTCCTCGGCATCCACAGGTCAGGCCACCCCT
CTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACCCCTCTTCTTGTCACC
GACGCTTCCTCAGTATCCACAGGTCACGCCACCCCTCTTCCTGTCACCGACACTTCCTCA
GCATCCACAGGTGACACCACCCGTCTTCCTGTCACGGACACTTCCTCAGCATCCACAGGT
CAGGCCACCCCTCTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACCCCT
CTTCTTGTCACCGACGCTTCCTCAGTATCCACAGGTCACGCCACCCCTCTTCCTGTCACC
GACACTTCCTCAGCATCCACAGGTGACACCACCCGTCTTCCTGTCACGGACACTTCCTCA
GCATCCACAGGTCAGGCCACCCCTCTTCCTGTCACCATCCCTTCCTCATCATCCTCAGGT
CACACCACCCCTCTTCCTGTCACCAGCACTTCCTCAGTATCTACAGGTCACGTCACCCCT
CTTCATGTCACCAGCCCTTCCTCAGCATCCACAGGTCACGTCACCCCTCTTCCTGTCACC
AGCACTTCCTCAGCATCCACAGGTCACGCCACCCCTCTTCTTGTCACCGACGCTTCCTCA
GTGTCCACAGGTCACGCCACGCCTCTTCCTGTCACCGACGCTTCCTCAGCATCCACAGGT
GACACCACCCCTCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTCAGGCCACCCCT
CTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACCCCTCTTCCTGTCACC
GACGCTTCCTCAGCATCCACAGGTCACGCCACCCCTCTTCCTGTCACCATCCCTTCCTCA
GTATCCACAGGTGACACCATGCCTCTTCCTGTCACTAGCCCTTCCTCAGCATCCACAGGT
CACGCCACCCCTCTTCCTGTTACCGGCCTTTCCTCAGCTTCCACAGGTGACACCACCCCT
CTTCCTGTCACCGACACTTCCTCAGCATCCACACGTCACGCCACCCCTCTTCCTGTCACC
GACACTTCCTCAGCTTCCACAGATGACACCACCCGTCTTCCTGTCACCGACGTTTCCTCG
GCATCCACAGGACATGCCACCCCTCTTCCTGTCACCAGCACTTCCTCAGCATCCACAGGT
GACACCACCCCTCTTCCTGTCACCGACACTTCCTCAGTATCCACAGGTCACGCCACCTCT
CTTCCTGTCACCAGCCGTTCCTCAGCATCCACAGGTCACGCCACCCCCCTTCCTGTCACC
GACACTTCCTCAGTATCCACAGGTCACGCCACCCCTCTTCCTGTCACCAGCACTTCCTCA
GTATCTACAGGTCACGCCACCCCTCTTCCTGTCACCAGCCCTTCCTCAGCATCCACAGGT
CACGCCACCCCTGTTCCTGTCACCAGCACTTCCTCAGCATCCACAGGTGACACCACCCCT
CTTCCTGTCACCAATGCTTCCTCATTATCCACAGGTCACGCCACCCCTCTTCATGTCACC
AGCCCTTCCTCAGCATCCAGAGGTGACACCAGCACTCTTCCTGTCACCGATGCTTCCTCA
GCATCCACCGGTCACGCCACCCCTCTTCCTCTCACCAGCCTTTCCTCAGTATCCACAGGT
GACACCACGCCTCTTCCTGTCACCGACACTTCCTCTGCATCCACAGGTCAGGCCACCCCT
CTTCCTGTCACCAGCCTTTCCTCAGTATCCACAGGTGACACCACGCCTCTTCCTGTCACC
ATCCCTTCCTCAGCATCCTCAGGTCACACCACCTCTCTTCCTGTCACCGACGCTTCCTCA
GTGTCCACAGGTCACGGCACCCCTCTTCCTGTCACCAGCACTTCCTCAGCATCCACAGGT
GACACCACCCCTCTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTCACGCCACCCCT
CTTCCTGTCACCGACACTTCCTCAGCATCCACAGGTCACGCCACCCCTCTTCCTGTCACC
AGCCTTTCCTCAGTATCCACAGGTCACGCCACCCCTCTTGCTGTCAGCAGTGCTACCTCA
GCTTCCACAGTATCCTCGGACTCCCCTCTGAAGATGGAAACACCAGGAATGACAACACCG
TCACTGAAGACAGACGGTGGGAGACGCACAGCCACATCACCACCCCCCACAACCTCCCAG
ACCATCATTTCCACCATTCCCAGCACTGCCATGCACACCCGCTCCACAGCTGCCCCCATC
CCCATCCTGCCTGAGAGAGGAGTTTCCCTCTTCCCCTATGGGGCAGGCGCCGGGGACCTG
GAGTTCGTCAGGAGGACCGTGGACTTCACCTCCCCACTCTTCAAGCCGGCGACTGGCTTC
CCCCTTGGCTCCTCTCTCCGTGATTCCCTCTACTTCACAGACAATGGCCAGATCATCTTC
CCAGAGTCAGACTACCAGATTTTCTCCTACCCCAACCCACTCCCAACAGGCTTCACAGGC
CGGGACCCTGTGGCCCTGGTGGCTCCGTTCTGGGACGATGCTGACTTCTCCACTGGTCGG
GGGACCACATTTTATCAGGAATACGAGACGTTCTATGGTGAACACAGCCTGCTAGTCCAG
CAGGCCGAGTCTTGGATTAGAAAGATGACAAACAACGGGGGCTACAAGGCCAGGTGGGCC
CTAAAGGTCACGTGGGTCAATGCCCACGCCTATCCTGCCCAGTGGACCCTCGGGAGCAAC
ACCTACCAAGCCATCCTCTCCACGGACGGGAGCAGGTCCTATGCCCTGTTTCTCTACCAG
AGCGGTGGGATGCAGTGGGACGTGGCCCAGCGCTCAGGCAACCCGGTGCTCATGGGCTTC
TCTAGTGGAGATGGCTATTTCGAAAACAGCCCACTGATGTCCCAGCCAGTGTGGGAGAGG
TATCGCCCTGATAGATTCCTGAATTCCAACTCAGGCCTCCAAGGGCTGCAGTTCTACAGG
CTACACCGGGAAGAAAGGCCCAACTACCGTCTCGAGTGCCTGCAGTGGCTGAAGAGCCAG
CCTCGGTGGCCCAGCTGGGGCTGGAACCAGGTCTCCTGCCCTTGTTCCTGGCAGCAGGGA
CGACGGGACTTACGATTCCAACCCGTCAGCATAGGTCGCTGGGGCCTCGGCAGTAGGCAG
CTGTGCAGCTTCACCTCTTGGCGAGGAGGCGTGTGCTGCAGCTACGGGCCCTGGGGAGAG
TTTCGTGAAGGCTGGCACGTGCAGCGTCCTTGGCAGTTGGCCCAGGAACTGGAGCCACAG
AGCTGGTGCTGCCGCTGGAATGACAAGCCCTACCTCTGTGCCCTGTACCAGCAGAGGCGG
CCCCACGTGGGCTGTGCTACATACAGGCCCCCACAGCCCGCCTGGATGTTCGGGGACCCC
CACATCACCACCTTGGATGGTGTCAGTTACACCTTCAATGGGCTGGGGGACTTCCTGCTG
GTCGGGGCCCAAGACGGGAACTCCTCCTTCCTGCTTCAGGGCCGCACCGCCCAGACTGGC
TCAGCCCAGGCCACCAACTTCATCGCCTTTGCGGCTCAGTACCGCTCCAGCAGCCTGGGC
CCCGTCACGGTCCAATGGCTCCTTGAGCCTCACGACGCAATCCGTGTCCTGCTGGATAAC
CAGACTGTGACATTTCAGCCTGACCATGAAGACGGCGGAGGCCAGGAGACGTTCAACGCC
ACCGGAGTCCTCCTGAGCCGCAACGGCTCTGAGGTCTCGGCCAGCTTCGACGGCTGGGCC
ACCGTCTCGGTGATCGCGCTCTCCAACATCCTCCACGCCTCCGCCAGCCTCCCGCCCGAG
TACCAGAACCGCACGGAGGGGCTCCTGGGGGTCTGGAATAACAATCCAGAGGACGACTTC
AGGATGCCCAATGGCTCCACCATTCCCCCAGGGAGCCCTGAGGAGATGCTTTTCCACTTT
GGAATGACCTGGCAGATCAACGGGACAGGCCTCCTTGGCAAGAGGAATGACCAGCTGCCT
TCCAACTTCACCCCTGTTTTCTACTCACAACTGCAAAAAAACAGCTCCTGGGCTGAACAT
TTGATCTCCAACTGTGACGGAGATAGCTCATGCATCTATGACACCCTGGCCCTGCGCAAC
GCAAGCATCGGACTTCACACGAGGGAAGTCAGTAAAAACTACGAGCAGGCGAACGCCACC
CTCAATCAGTACCCGCCCTCCATCAATGGTGGTCGTGTGATTGAAGCCTACAAGGGGCAG
ACCACGCTGATTCAGTACACCAGCAATGCTGAGGATGCCAACTTCACGCTCAGAGACAGC
TGCACCGACTTGGAGCTCTTTGAGAATGGGACGTTGCTGTGGACACCCAAGTCGCTGGAG
CCATTCACTCTGGAGATTCTAGCAAGAAGTGCCAAGATTGGCTTGGCATCTGCACTCCAG
CCCAGGACTGTGGTCTGCCATTGCAATGCAGAGAGCCAGTGTTTGTACAATCAGACCAGC
AGGGTGGGCAACTCCTCCCTGGAGGTGGCTGGCTGCAAGTGTGACGGGGGCACCTTCGGC
CGCTACTGCGAGGGCTCCGAGGATGCCTGTGAGGAGCCGTGCTTCCCGAGTGTCCACTGC
GTTCCTGGGAAGGGCTGCGAGGCCTGCCCTCCAAACCTGACTGGGGATGGGCGGCACTGT
GCGGCTCTGGGGAGCTCTTTCCTGTGTCAGAACCAGTCCTGCCCTGTGAATTACTGCTAC
AATCAAGGCCACTGCTACATCTCCCAGACTCTGGGCTGTCAGCCCATGTGCACCTGCCCC
CCAGCCTTCACTGACAGCCGCTGCTTCCTGGCTGGGAACAACTTCAGTCCAACTGTCAAC
CTAGAACTTCCCTTAAGAGTCATCCAGCTCTTGCTCAGTGAAGAGGAAAATGCCTCCATG
GCAGAAGTCAACGCCTCGGTGGCATACAGACTGGGGACCCTGGACATGCGGGCCTTTCTC
CGCAACAGCCAAGTGGAACGAATCGATTCTGCAGCACCGGCCTCGGGAAGCCCCATCCAA
CACTGGATGGTCATCTCGGAGTTCCAGTACCGCCCTCGGGGCCCGGTCATTGACTTCCTG
AACAACCAGCTGCTGGCCGCGGTGGTGGAGGCGTTCTTATACCACGTTCCACGGAGGAGT
GAGGAGCCCAGGAACGACGTGGTCTTCCAGCCCATCTCCGGGGAAGACGTGCGCGATGTG
ACAGCCCTGAACGTGAGCACGCTGAAGGCTTACTTCAGATGCGATGGCTACAAGGGCTAC
GACCTGGTCTACAGCCCCCAGAGCGGCTTCACCTGCGTGTCCCCGTGCAGTAGGGGCTAC
TGTGACCATGGAGGCCAGTGCCAGCACCTGCCCAGTGGGCCCCGCTGCAGCTGTGTGTCC
TTCTCCATCTACACGGCCTGGGGCGAGCACTGTGAGCACCTGAGCATGAAACTCGACGCG
TTCTTCGGCATCTTCTTTGGGGCCCTGGGCGGCCTCTTGCTGCTGGGGGTCGGGACGTTC
GTGGTCCTGCGCTTCTGGGGTTGCTCCGGGGCCAGGTTCTCCTATTTCCTGAACTCAGCT
GAGGCCTTGCCTTGAAGGGGCAGCTGTGGCCTAGGCTACCTCAAGACTCACCTCATCCTT
ACCGCACATTTAAGGCGCCATTGCTTTTGGGAGACTGGAAAAGGGAAGGTGACTGAAGGC
TGTCAGGATTCTTCAAGGAGAATGAATACTGGGAATCAAGACAAGACTATACCTTATCCA
TAGGCGCAGGTGCACAGGGGGAGGCCATAAAGATCAAACATGCATGGATGGGTCCTCACG
CAGACACACCCACAGAAGGACACTAGCCTGTGCACGCGCGCGTGCACACACACACACACA
CACACGAGTTCATAATGTGGTGATGGCCCTAAGTTAAGCAAAATGCTTCTGCACACAAAA
CTCTCTGGTTTACTTCAAATTAACTCTATTTAAATAAAGTCTCTCTGACTTTTTGTGTCT
CCAAAAAAAAAAAAAAAAA

Protein Sequence

>4585 : length: 5412
MKGARWRRVPWVSLSCLCLCLLPHVVPGTTEDTLITGSKTAAPVTSTGSTTATLEGQSTA
ASSRTSNQDISASSQNHQTKSTETTSKAQTDTLTQMMTSTLFSSPSVHNVMETAPPDEMT
TSFPSSVTNTLMMTSKTITMTTSTDSTLGNTEETSTAGTESSTPVTSAVSITAGQEGQSR
TTSWRTSIQDTSASSQNHWTRSTQTTRESQTSTLTHRTTSTPSFSPSVHNVTGTVSQKTS
PSGETATSSLCSVTNTSMMTSEKITVTTSTGSTLGNPGETSSVPVTGSLMPVTSAALVTF
DPEGQSPATFSRTSTQDTTAFSKNHQTQSVETTRVSQINTLNTLTPVTTSTVLSSPSGFN
PSGTVSQETFPSGETTTSSPSSVSNTFLVTSKVFRMPTSRDSTLGNTEETSLSVSGTISA
ITSKVSTIWWSDTLSTALSPSSLPPKISTAFHTQQSEGAETTGRPHERSSFSPGVSQEIF
TLHETTTWPSSFSSKGHTTWSQTELPSTSTGAATRLVTGNPSTGTAGTIPRVPSKVSAIG
EPGEPTTYSSHSTTLPKTTGAGAQTQWTQETGTTGEALLSSPSYSVTQMIKTATSPSSSP
MLDRHTSQQITTAPSTNHSTIHSTSTSPQESPAVSQRGHTQAPQTTQESQTTRSVSPMTD
TKTVTTPGSSFTASGHSPSEIVPQDAPTISAATTFAPAPTGDGHTTQAPTTALQAAPSSH
DATLGPSGGTSLSKTGALTLANSVVSTPGGPEGQWTSASASTSPDTAAAMTHTHQAESTE
ASGQTQTSEPASSGSRTTSAGTATPSSSGASGTTPSGSEGISTSGETTRFSSNPSRDSHT
TQSTTELLSASASHGAIPVSTGMASSIVPGTFHPTLSEASTAGRPTGQSSPTSPSASPQE
TAAISRMAQTQRTRTSRGSDTISLASQATDTFSTVPPTPPSITSTGLTSPQTETHTLSPS
GSGKTFTTALISNATPLPVTYASSASTGHTTPLHVTDASSVSTGHATPLPVTSPSSVSTG
HTTPLPVTDTSSESTGHVTPLPVTSFSSASTGDSTPLPVTDTSSASTGHVTPLPVTSLSS
ASTGDTTPLPVTDTSSASTGHATSLPVTDTSSVSTGHTTPLPVTDTSSASTGHATSLPVT
DTSSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATP
LLVTDTSSASTGHATPLPVTDASSVSTDHATSLPVTIPSAASTGHTTPLPVTDTSSASTG
QATSLLVTDTSSVSTGDTTPLPVTSTSSASTGHVTPLHVTSPSSASTGHATPLPVTSLSS
ASTGDTMPLPVTSPSSASTGDTTPLPVTDASSVSTGHTTPLHVTDASSASTGQATPLPVT
SLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPLPVTDASSVSTDHATS
LPVTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPVTSTSSASTG
HVTPLHVTSPSSASTGHATPLPVTSLSSASTGDTMPLPVTSPSSASTGDTTPLPVTDASS
VSTGHTTPLPVTSPSSASTGHTTPLPVTDTSSASKGDTTPLPVTSPSSASTGHTTPLPVT
DTSSASTGDTTPLPVTNASSLSTGHATPLHVTSPSSASTGHATPLPVTSTSSASTGHATP
LPVTGLSSATTDDTTRLPVTDVSSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTG
HASPLLVTDASSASTGQATPLPVTDTSSVSTAHATPLPVTGLSSASTDDTTRLPVTDVSS
ASTGQAIPLPVTSPSSASTGDTTPLPVTDASSASTGDTTSLPVTIPSSASSGHTTSLPVT
DASSVSTGHATSLLVTDASSVSTGDTTPLPVTDTNSASTGDTTPLHVTDASSVSTGHATS
LPVTSLSSASTGDTTPLPVTSPSSASSGHTTPLPVTDASSVPTGHATSLPVTDASSVSTG
HATPLPVTDASSVSTGHATPLPVTDTSSVSTGQATPLPVTSLSSASTGDTTPLPVTDTSS
ASTGQDTPLPVTSLSSVSTGDTTPLPVTNPSSASTGHATPLLVTDASSISTGHATSLLVT
DASSVSTGHATALHDTDASSLSTGDTTPLPVTSPSSTSTGDTTPLPVTETSSVSTGHATS
LPVTDTSSASTGHATSLPVTDTSSASTGHATPLPVTDTSSASTGQATPLPVTSPSSASTG
HAIPLLVTDTSSASTGQATPLPVTSLSSASTGDTTPLPVTDASSVSTGHATSLPVTSLSS
VSTGDTTPLPVTSPSSASTGHATPLHVTDASSASTGHATPLPVTSLSSASTGDTTPLPVT
SPSSASTGHATPLHVTDASSVSTGDTTPLPVTSSSSASSGHTTPLPVTDASSASTGDTTP
LPVTDTSSASTGHATHLPVTGLSSASTGDTTRLPVTNVSSASTGHATPLPVTSTSSASTG
DTTPLPGTDTSSVSTGHTTPLLVTDASSVSTGDTTRLPVTSPSSASTGHTTPLPVTDTPS
ASTGDTTPLPVTNASSLSTRHATSLHVTSPSSASTGHATSLPVTDTSAASTGHATPLPVT
STSSASTGDTTPLPVTDTYSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATP
LLVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATSLPVTDTSSASTG
DTTSLPVTDTSSAYTGDTTSLPVTDTSSSSTGDTTPLLVTETSSVSTGDTTPLPVTDTSS
ASTGHATPLPVTNTSSVSTGHATPLHVTSPSSASTGHTTPLPVTDASSVSTGHATSLPVT
DASSVFTGHATSLPVTIPSSASSGHTTPLPVTDASSVSTGHATSLPVTDASSVSTGHATP
LPVTDASSVSTGHATPLPLTSLSSVSTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTG
DTTPLPVTDTSSASTGHATSLPVTDTSSASTGHATPLPDTDTSSASTGHATLLPVTDTSS
ASIGHATSLPVTDTSSISTGHATPLHVTSPSSASTGHATPLPVTDTSSASTGHANPLHVT
SPSSASTGHATPLPVTDTSSASTGHATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHTTP
LPVTDTSSASTGQATALPVTSTSSASTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTG
DTTPLPVTSPSSASTGHATPLLVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSS
ASTGHATSLPVTDTSSASTGDTTSLPVTDTSSAYTGDTTSLPVTDTSSSSTGDTTPLLVT
ETSSVSTGHATPLLVTDASSASTGHATPLHVTSPSSASTGDTTPVPVTDTSSVSTGHATP
LPVTGLSSASTGDTTRLPVTDISSASTGQATPLPVTNTSSVSTGDTMPLPVTSPSSASTG
HATPLPVTSTSSASTGHATPVPVTSTSSASTGHTTPLPVTDTSSASTGDTTPLPVTSPSS
ASTGHTTPLHVTIPSSASTGDTSTLPVTGASSASTGHATPLPVTDTSSVSTGHATPLPVT
SLSSVSTGDTTPLPVTDASSASTGQATPLPVTSLSSVSTGDTTPLLVTDASSVSTGHATP
LPVTDTSSASTGDTTRLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLLVTDASSVSTG
HATPLPVTDTSSASTGDTTRLPVTDTSSASTGQATPLPVTIPSSSSSGHTTPLPVTSTSS
VSTGHVTPLHVTSPSSASTGHVTPLPVTSTSSASTGHATPLLVTDASSVSTGHATPLPVT
DASSASTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTDASSASTGHATP
LPVTIPSSVSTGDTMPLPVTSPSSASTGHATPLPVTGLSSASTGDTTPLPVTDTSSASTR
HATPLPVTDTSSASTDDTTRLPVTDVSSASTGHATPLPVTSTSSASTGDTTPLPVTDTSS
VSTGHATSLPVTSRSSASTGHATPLPVTDTSSVSTGHATPLPVTSTSSVSTGHATPLPVT
SPSSASTGHATPVPVTSTSSASTGDTTPLPVTNASSLSTGHATPLHVTSPSSASRGDTST
LPVTDASSASTGHATPLPLTSLSSVSTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTG
DTTPLPVTIPSSASSGHTTSLPVTDASSVSTGHGTPLPVTSTSSASTGDTTPLPVTDTSS
ASTGHATPLPVTDTSSASTGHATPLPVTSLSSVSTGHATPLAVSSATSASTVSSDSPLKM
ETPGMTTPSLKTDGGRRTATSPPPTTSQTIISTIPSTAMHTRSTAAPIPILPERGVSLFP
YGAGAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPN
PLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHSLLVQQAESWIRKMTNN
GGYKARWALKVTWVNAHAYPAQWTLGSNTYQAILSTDGSRSYALFLYQSGGMQWDVAQRS
GNPVLMGFSSGDGYFENSPLMSQPVWERYRPDRFLNSNSGLQGLQFYRLHREERPNYRLE
CLQWLKSQPRWPSWGWNQVSCPCSWQQGRRDLRFQPVSIGRWGLGSRQLCSFTSWRGGVC
CSYGPWGEFREGWHVQRPWQLAQELEPQSWCCRWNDKPYLCALYQQRRPHVGCATYRPPQ
PAWMFGDPHITTLDGVSYTFNGLGDFLLVGAQDGNSSFLLQGRTAQTGSAQATNFIAFAA
QYRSSSLGPVTVQWLLEPHDAIRVLLDNQTVTFQPDHEDGGGQETFNATGVLLSRNGSEV
SASFDGWATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDFRMPNGSTIPPGS
PEEMLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFYSQLQKNSSWAEHLISNCDGDSSCI
YDTLALRNASIGLHTREVSKNYEQANATLNQYPPSINGGRVIEAYKGQTTLIQYTSNAED
ANFTLRDSCTDLELFENGTLLWTPKSLEPFTLEILARSAKIGLASALQPRTVVCHCNAES
QCLYNQTSRVGNSSLEVAGCKCDGGTFGRYCEGSEDACEEPCFPSVHCVPGKGCEACPPN
LTGDGRHCAALGSSFLCQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAG
NNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAA
PASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPI
SGEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPS
GPRCSCVSFSIYTAWGEHCEHLSMKLDAFFGIFFGALGGLLLLGVGTFVVLRFWGCSGAR
FSYFLNSAEALP