ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4515

Name

MTCP1

Synonym

P13MTCP1|p8MTCP1;mature T-cell proliferation 1;MTCP1;mature T-cell proliferation 1

Definition

MTCP-1 type B1|mature T-cell proliferation 1 isoform p13|mature T-cell proliferation-1 type B1|protein p13 MTCP-1

Position

Xq28

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4515

Links to epithelial mesenchymal transition gene database

4515

Links to ovarian cancer gene database

4515

Links to endometrial cancer gene database

4515

Links to iHOP

4515

Sequence Information

Nucleotide Sequence

>4515 : length: 2329
CAGCACCTGGGAAACGCCCGCGCGGTTTGGGGCAGGCGTGGCCGTCGGGGCGGAGGGCGG
TGGCCGGCCGCGGTCCGGGCGTCAGGCCGGGCGGCGGGGGCGGCAGGGAGGCGGCGCTCT
GGGGCCGCAGGCGGACGTACTCTGTGAGCGGCGCCCGGGCGCCTGGGCAGGCGCCTCCCG
AGTACCGGCGCCCATTTTGCCCGCCCGCTAAGGAGACCCGTGCGCGGCCTACACGCTTGG
GGGACAGCCCTTTAAGACGACATCTCCGCGAACGCCGGCCTCTTGAGCCAGGGGGACGCT
CTTTTGAAAGTCAGTCCCAAAACAGTTAAGGTTTTATTTTATTTTGTTTTATTTCCAAGT
CACAGCCCCCGAATCTCGTACAACTCTCCCTGGACCACTTCCGGTTGCCGGCCCGCGCCT
CATAACTTCGGTTCGAGTGACCTCGGCCCGGGATGCCCCTCGGCTCACCCCGGGCTCACG
TCGCGATCCTGGCTTGAGTGGCCCAGGGTGGGAGACCTGGAAGTTTTAGCCTAGCTGTTC
TCAAGGCGGATTAATTAGCCCAAGAAACATTATATTCATGCTTAGGTGGAGAAAAGCAGG
GCTAGAATTGGAACCCAAAGCCCAGAATGGCAGGAGAGGATGTGGGGGCTCCACCCGATC
ACCTCTGGGTTCACCAAGAGGGTATCTACCGCGACGAATACCAGCGCACGTGGGTGGCCG
TCGTGGAAGAGGAGACGAGTTTCCTAAGGGCACGAGTCCAGCAAATTCAGGTTCCCTTAG
GTGACGCAGCTAGGCCAAGTCACCTTCTTACCTCCCAGCTACCTCTCATGTGGCAACTCT
ACCCGGAGGAGCGCTACATGGATAACAACTCTCGCTTGTGGCAGATACAGCATCATTTAA
TGGTCAGGGGAGTACAGGAGCTGTTGCTTAAGCTTTTGCCTGATGACTAACCTGGTGCTG
GGATTCTACGAAGATATGCTCCTTTGTTCTGTTCAGTATTTGGCAATCACTTCATCCACT
ACTGCAGTGCACCCACCCTTGGGCCTGGGGGGAGGGAGTGGGTTGAAAAACTGCTCAAGA
AACAGAAGTTTAGCAAGGGTCATGAAGAATACTGCAAGTGAAACTGCAGAGAGAGGTTAC
GTAGGCAGAAAGCAAGTCAACAAAAGCACTTAGTCAGGATCCGTAACTTGAAATTGACTC
CTTTGGAAATTGCCATAGAACCCTTAATGGACATCATCGGCTGGACCTGGGATCTGATGA
ATCCCACAAAAGTCAGCACCTTCTACAGAACAGATGCCCTGATCACCAAGGACTTGGTAC
TGATTTAGAGAGAAGAGAGCAGCTCCTAGCAGCATCAACATCTATTTGTCGCTTATTTGC
CCTGCAGCAATTCACCTGCCTTTCCTTCTCCCATCCTGTAAATATCCTAGGTTTTGCTCC
AGTGTTTCCCATCCCAGTACTGACCTAATTTGGATCTGCTGAGTATTTAGAGGGCTCTGA
AAAGAGATATGCATTGATGAAATTAGCTACAAAGGCTTGTGGGCCTTTTTTTCTATCTGA
AATCGTGTCTTCAAATTACTGGAAGTTGCTGATCAAAATTGTGGGCTCTTGAATTCATTC
TCTGATTACAGATATTTTAAATAAGCTGGTTTCTATAAGAACTTCAAGAAAAACCATTTT
AGCTGCTTAACTGGCACCTTTCTCAGGAAGTAATAACACCAAATATTGCTGATTCCTAGG
AAAACATTTACTACTTGTAAAGAATTTCCTGAGTTAAAGTAGTTATAACAGTTTATATAC
ATTAAAAGTAAGGTTTTACTTTAAAAAAAAAAGTCTTGGGAATAATAGCTACCATGTATT
GGAGTCCTTTCCAGGCACTATTGTATGTACTTTATATACTTTATCACATTTAATCCTCCT
GTCAATGCTTTGAGGTAGGTATGATTCCCATTTTATATATGAGTAATAAAAAAAGCTCAA
GGAGTTTAATCATTTATCAAGGGTTTCTTCTGCGAATGATAGAGCCAGGCTGCGCCGTCG
GCTCCTCTAGCCTAACGTTGGTTTACAGTATTCAAAAAGAGTTGATTGAATTCAAGGTTT
TTTTTCCATGTAAAGCTATTTATATCTTCCAAGCCTAATGAAATGGATATTATAAAAATA
CAGTTGATTCATCCTATGTTTGGGAAGAGTATTTTTAGTGTAATTATTTTCCAGCAATTG
TAAGGGCATATACTGCTTGTCTCAGAAGAAAATTCCACGTAGAGGGGCTTTAAAGTCTTT
ATGGAAAAAAGAAAAATAAAAATCATTTTTCTTGTTTTAGAAAAAAAAA

Protein Sequence

>4515 : length: 107
MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHL
LTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD