ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4486

Name

MST1R

Synonym

CD136|CDw136|PTK8|RON;macrophage stimulating 1 receptor;MST1R;macrophage stimulating 1 receptor

Definition

MSP receptor|MST1R variant RON30|MST1R variant RON62|PTK8 protein tyrosine kinase 8|RON variant 21|RON variant E2E3|c-met-related tyrosine kinase|macrophage stimulating 1 receptor (c-met-related tyrosine kinase)|macrophage-stimulating protein receptor|p18

Position

3p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

amb2 Integrin signaling;PID Curated;200108

Disease

Ulcerative colitis;FunDO

Disease

Endometriosis;FunDO

Disease

Cancer;FunDO

Disease

Enteritis;FunDO

Disease

Multiple sclerosis;FunDO

External Links

Links to cell senescence gene database

4486

Links to epithelial mesenchymal transition gene database

4486

Links to ovarian cancer gene database

4486

Links to endometrial cancer gene database

4486

Links to iHOP

4486

Sequence Information

Nucleotide Sequence

>4486 : length: 4785
AGTGTACAGCGGCGGCTGGGGCGGCAGGTGAGGCGGCTGGGGCGTTGCTGTCGTGCGTCC
GCAGGCGTCAGGTGCTCAGACCCGAGGGCCGGGAAGGGATTTGGGTTTCACAGGAACCTG
GGGCGGGGGTCCGCTATCTTGGGGCTGTCGGGACCGCTGCTTAAATTTGGCCCAGTCCAG
ACCTCGAGTCGGGCCCCCAGCCAGGCCCACGCCCAGGTCCAGGCCCAGGCCGGTAGGGAT
CCTCTAGGGTCCCAGCTCGCCTCGATGGAGCTCCTCCCGCCGCTGCCTCAGTCCTTCCTG
TTGCTGCTGCTGTTGCCTGCCAAGCCCGCGGCGGGCGAGGACTGGCAGTGCCCGCGCACC
CCCTACGCGGCCTCTCGCGACTTTGACGTGAAGTACGTGGTGCCCAGCTTCTCCGCCGGA
GGCCTGGTACAGGCCATGGTGACCTACGAGGGCGACAGAAATGAGAGTGCTGTGTTTGTA
GCCATACGCAATCGCCTGCATGTGCTTGGGCCTGACCTGAAGTCTGTCCAGAGCCTGGCC
ACGGGCCCTGCTGGAGACCCTGGCTGCCAGACGTGTGCAGCCTGTGGCCCAGGACCCCAC
GGCCCTCCCGGTGACACAGACACAAAGGTGCTGGTGCTGGATCCCGCGCTGCCTGCGCTG
GTCAGTTGTGGCTCCAGCCTGCAGGGCCGCTGCTTCCTGCATGACCTAGAGCCCCAAGGG
ACAGCCGTGCATCTGGCAGCGCCAGCCTGCCTCTTCTCAGCCCACCATAACCGGCCCGAT
GACTGCCCCGACTGTGTGGCCAGCCCATTGGGCACCCGTGTAACTGTGGTTGAGCAAGGC
CAGGCCTCCTATTTCTACGTGGCATCCTCACTGGACGCAGCCGTGGCTGCCAGCTTCAGC
CCACGCTCAGTGTCTATCAGGCGTCTCAAGGCTGACGCCTCGGGATTCGCACCGGGCTTT
GTGGCGTTGTCAGTGCTGCCCAAGCATCTTGTCTCCTACAGTATTGAATACGTGCACAGC
TTCCACACGGGAGCCTTCGTATACTTCCTGACTGTACAGCCGGCCAGCGTGACAGATGAT
CCTAGTGCCCTGCACACACGCCTGGCACGGCTTAGCGCCACTGAGCCAGAGTTGGGTGAC
TATCGGGAGCTGGTCCTCGACTGCAGATTTGCTCCAAAACGCAGGCGCCGGGGGGCCCCA
GAAGGCGGACAGCCCTACCCTGTGCTGCGGGTGGCCCACTCCGCTCCAGTGGGTGCCCAA
CTTGCCACTGAGCTGAGCATCGCCGAGGGCCAGGAAGTACTATTTGGGGTCTTTGTGACT
GGCAAGGATGGTGGTCCTGGCGTGGGCCCCAACTCTGTCGTCTGTGCCTTCCCCATTGAC
CTGCTGGACACACTAATTGATGAGGGTGTGGAGCGCTGTTGTGAATCCCCAGTCCATCCA
GGCCTCCGGCGAGGCCTCGACTTCTTCCAGTCGCCCAGTTTTTGCCCCAACCCGCCTGGC
CTGGAAGCCCTCAGCCCCAACACCAGCTGCCGCCACTTCCCTCTGCTGGTCAGTAGCAGC
TTCTCACGTGTGGACCTATTCAATGGGCTGTTGGGACCAGTACAGGTCACTGCATTGTAT
GTGACACGCCTTGACAACGTCACAGTGGCACACATGGGCACAATGGATGGGCGTATCCTG
CAGGTGGAGCTGGTCAGGTCACTAAACTACTTGCTGTATGTGTCCAACTTCTCACTGGGT
GACAGTGGGCAGCCCGTGCAGCGGGATGTCAGTCGTCTTGGGGACCACCTACTCTTTGCC
TCTGGGGACCAGGTTTTCCAGGTACCTATCCAAGGCCCTGGCTGCCGCCACTTCCTGACC
TGTGGGCGTTGCCTAAGGGCATGGCATTTCATGGGCTGTGGCTGGTGTGGGAACATGTGC
GGCCAGCAGAAGGAGTGTCCTGGCTCCTGGCAACAGGACCACTGCCCACCTAAGCTTACT
GAGTTCCACCCCCACAGTGGACCTCTAAGGGGCAGTACAAGGCTGACCCTGTGTGGCTCC
AACTTCTACCTTCACCCTTCTGGTCTGGTGCCTGAGGGAACCCATCAGGTCACTGTGGGC
CAAAGTCCCTGCCGGCCACTGCCCAAGGACAGCTCAAAACTCAGACCAGTGCCCCGGAAA
GACTTTGTAGAGGAGTTTGAGTGTGAACTGGAGCCCTTGGGCACCCAGGCAGTGGGGCCT
ACCAACGTCAGCCTCACCGTGACTAACATGCCACCGGGCAAGCACTTCCGGGTAGACGGC
ACCTCCGTGCTGAGAGGCTTCTCTTTCATGGAGCCAGTGCTGATAGCAGTGCAACCCCTC
TTTGGCCCACGGGCAGGAGGCACCTGTCTCACTCTTGAAGGCCAGAGTCTGTCTGTAGGC
ACCAGCCGGGCTGTGCTGGTCAATGGGACTGAGTGTCTGCTAGCACGGGTCAGTGAGGGG
CAGCTTTTATGTGCCACACCCCCTGGGGCCACGGTGGCCAGTGTCCCCCTTAGCCTGCAG
GTGGGGGGTGCCCAGGTACCTGGTTCCTGGACCTTCCAGTACAGAGAAGACCCTGTCGTG
CTAAGCATCAGCCCCAACTGTGGCTACATCAACTCCCACATCACCATCTGTGGCCAGCAT
CTAACTTCAGCATGGCACTTAGTGCTGTCATTCCATGACGGGCTTAGGGCAGTGGAAAGC
AGGTGTGAGAGGCAGCTTCCAGAGCAGCAGCTGTGCCGCCTTCCTGAATATGTGGTCCGA
GACCCCCAGGGATGGGTGGCAGGGAATCTGAGTGCCCGAGGGGATGGAGCTGCTGGCTTT
ACACTGCCTGGCTTTCGCTTCCTACCCCCACCCCATCCACCCAGTGCCAACCTAGTTCCA
CTGAAGCCTGAGGAGCATGCCATTAAGTTTGAGTATATTGGGCTGGGCGCTGTGGCTGAC
TGTGTGGGTATCAACGTGACCGTGGGTGGTGAGAGCTGCCAGCACGAGTTCCGGGGGGAC
ATGGTTGTCTGCCCCCTGCCCCCATCCCTGCAGCTTGGCCAGGATGGTGCCCCATTGCAG
GTCTGCGTAGATGGTGAATGTCATATCCTGGGTAGAGTGGTGCGGCCAGGGCCAGATGGG
GTCCCACAGAGCACGCTCCTTGGTATCCTGCTGCCTTTGCTGCTGCTTGTGGCTGCACTG
GCGACTGCACTGGTCTTCAGCTACTGGTGGCGGAGGAAGCAGCTAGTTCTTCCTCCCAAC
CTGAATGACCTGGCATCCCTGGACCAGACTGCTGGAGCCACACCCCTGCCTATTCTGTAC
TCGGGCTCTGACTACAGAAGTGGCCTTGCACTCCCTGCCATTGATGGTCTGGATTCCACC
ACTTGTGTCCATGGAGCATCCTTCTCCGATAGTGAAGATGAATCCTGTGTGCCACTGCTG
CGGAAAGAGTCCATCCAGCTAAGGGACCTGGACTCTGCGCTCTTGGCTGAGGTCAAGGAT
GTGCTGATTCCCCATGAGCGGGTGGTCACCCACAGTGACCGAGTCATTGGCAAAGGCCAC
TTTGGAGTTGTCTACCACGGAGAATACATAGACCAGGCCCAGAATCGAATCCAATGTGCC
ATCAAGTCACTAAGTCGCATCACAGAGATGCAGCAGGTGGAGGCCTTCCTGCGAGAGGGG
CTGCTCATGCGTGGCCTGAACCACCCGAATGTGCTGGCTCTCATTGGTATCATGTTGCCA
CCTGAGGGCCTGCCCCATGTGCTGCTGCCCTATATGTGCCACGGTGACCTGCTCCAGTTC
ATCCGCTCACCTCAGCGGAACCCCACCGTGAAGGACCTCATCAGCTTTGGCCTGCAGGTA
GCCCGCGGCATGGAGTACCTGGCAGAGCAGAAGTTTGTGCACAGGGACCTGGCTGCGCGG
AACTGCATGCTGGACGAGTCATTCACAGTCAAGGTGGCTGACTTTGGTTTGGCCCGCGAC
ATCCTGGACAGGGAGTACTATAGTGTTCAACAGCATCGCCACGCTCGCCTACCTGTGAAG
TGGATGGCGCTGGAGAGCCTGCAGACCTATAGATTTACCACCAAGTCTGATGTGTGGTCA
TTTGGTGTGCTGCTGTGGGAACTGCTGACACGGGGTGCCCCACCATACCGCCACATTGAC
CCTTTTGACCTTACCCACTTCCTGGCCCAGGGTCGGCGCCTGCCCCAGCCTGAGTATTGC
CCTGATTCTCTGTACCAAGTGATGCAGCAATGCTGGGAGGCAGACCCAGCAGTGCGACCC
ACCTTCAGAGTACTAGTGGGGGAGGTGGAGCAGATAGTGTCTGCACTGCTTGGGGACCAT
TATGTGCAGCTGCCAGCAACCTACATGAACTTGGGCCCCAGCACCTCGCATGAGATGAAT
GTGCGTCCAGAACAGCCGCAGTTCTCACCCATGCCAGGGAATGTACGCCGGCCCCGGCCA
CTCTCAGAGCCTCCTCGGCCCACTTGACTTAGTTCTTGGGCTGGACCTGCTTAGCTGCCT
TGAGCTAACCCCAAGCTGCCTCTGGGCCATGCCAGGCCAGAGGGCAGTGGCCCTCCACCT
TGTTCCTGCCCTTTAACTTTCAGAGGCAATAGGTAAATGGGGCCCATTAGGTCCCTCACT
CCACAGAGTGAGCCAGTGAGGGCAGTCCTGCAACATGTATTTATGGAGTGCCTGCTGTGG
ACCCTGTCTTCTGGGCACAGTGGACTCAGCAGTGACCACACCAACACTGACCCTTGAACC
AATAAAGGAACAAATGACTATTAAAGCACAAAAAAAAAAAAAAAA

Protein Sequence

>4486 : length: 1401
MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAW
HFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRQCERQLPEQQLCRLPEYVVRDPQGWVA
GNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVT
VGGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLL
GILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRS
GLALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAEVKDVLIPHER
VVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLN
HPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYL
AEQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESL
QTYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQV
MQQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQ
FSPMPGNVRRPRPLSEPPRPT