ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4440

Name

MSI1

Synonym

musashi RNA-binding protein 1;MSI1;musashi RNA-binding protein 1

Definition

RNA-binding protein Musashi homolog 1|musashi-1|musashi1

Position

12q24

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4440

Links to epithelial mesenchymal transition gene database

4440

Links to ovarian cancer gene database

4440

Links to endometrial cancer gene database

4440

Links to iHOP

4440

Sequence Information

Nucleotide Sequence

>4440 : length: 2989
CTTCGCCGCGCTCCTCATCTGCCCCGCGCCGAGCGCCGCCGCCGCCGCCGCCGCCGCCGC
TCCGCTGCCCGCGCCGCCCGCGGCTCCCGATGGAGACTGACGCGCCCCAGCCCGGCCTCG
CCTCCCCGGACTCGCCGCACGACCCCTGCAAGATGTTCATCGGGGGACTCAGTTGGCAGA
CTACGCAGGAAGGGCTGCGCGAATACTTCGGCCAGTTCGGGGAGGTGAAGGAGTGTCTGG
TGATGCGGGACCCCCTGACCAAGAGATCCAGGGGTTTCGGCTTCGTCACTTTCATGGACC
AGGCGGGGGTGGATAAAGTGCTGGCGCAATCGCGGCACGAGCTCGACTCCAAAACAATTG
ACCCTAAGGTGGCCTTCCCTCGGCGAGCACAGCCCAAGATGGTGACTCGAACGAAGAAGA
TCTTTGTGGGGGGGCTGTCGGTGAACACCACGGTGGAGGACGTGAAGCAATATTTTGAGC
AGTTTGGGAAGGTGGACGACGCCATGCTGATGTTTGACAAAACCACCAACCGGCACCGAG
GGTTCGGGTTTGTCACGTTTGAGAGTGAGGACATCGTGGAGAAAGTGTGTGAAATTCATT
TTCATGAAATCAACAACAAAATGGTGGAATGTAAGAAAGCTCAGCCAAAGGAGGTGATGT
CGCCAACGGGCTCAGCCCGGGGGAGGTCTCGAGTCATGCCCTACGGAATGGACGCCTTCA
TGCTGGGCATCGGCATGCTGGGTTACCCAGGTTTCCAAGCCACAACCTACGCCAGCCGGA
GTTATACAGGCCTCGCCCCTGGCTACACCTACCAGTTCCCCGAATTCCGTGTAGAGCGGA
CCCCTCTCCCGAGCGCCCCAGTCCTCCCCGAGCTTACAGCCATTCCTCTCACTGCCTACG
GACCAATGGCGGCGGCAGCGGCGGCAGCGGCTGTGGTTCGAGGGACAGGCTCTCACCCCT
GGACGATGGCTCCCCCTCCAGGTTCGACTCCCAGCCGCACAGGGGGCTTCCTGGGGACCA
CCAGCCCCGGCCCCATGGCCGAGCTCTACGGGGCGGCCAACCAGGACTCGGGGGTCAGCA
GTTACATCAGCGCCGCCAGCCCTGCCCCCAGCACCGGCTTCGGCCACAGTCTTGGGGGCC
CTTTGATTGCCACAGCCTTCACCAATGGGTACCACTGAAGCAGGGGACGGTGGCAGGAGC
GCCCCAGCCTGCAGCTGACTGAGGACCACGAGTGAGCCAGCGAGGGGGCGGGAGACCTCA
GCCGCAGCCGCCGCCCCCTCCCCTGCAGCGACTCGGACCCGCTACTGCCTGCCCCCAACT
CCCCGGGCCCGGCCCCTGCCCTGCTGCCCCCAACAGCGTCTGGCTCCCCTACTAACGTCC
CCCTCTTCGCCCTTGCCCCCATCCCCACCCGCCCCTCTCCCGGCCCTGCTTTTATTTATT
TTGGATTAGCCGGTTGCCCACCCCAGCCCTCTGGTCCATCCCTCCCTCCGTGCCGCGCCC
CCCTAGGACCGCCCCCTCCCCAAAAGGCTTTTGGATTTGTGCATAGCTGGAGTGAAGGCG
GAGGGAGCCTGCTACAGGCCGCAGCCCAACCCCTGTTTTTTATTCAGATTTCCCCTCCTT
TACCCTTTCCCTTTTTTTTTTTTTTTTTTTTTTTAAAGAAACCTTTTTTAAACTATTTCT
AGGTTTGTGAATGTGAAGCCCCAGGCCGCAGGGGGCAAGGGGCCAGGTGCCCCCCACCAG
CTGAGAACAAAGTGTCTATCTGGGTGTGGGCCCCTGGCCGCCTCCCTCCAGCCCTGGAGA
GGAGGGCAGGGCTGCGGGGAGGCCAGGCCGAGCCCCTGGAACCATCCCGTCCTGTATCAT
ATGTAAATACTGTGAGGTGATGTGCCCACCCCTCTCTAAGACCCCTCGGGGGTGAGGGGC
TCCCCCCTCCCCTGTTTCTGTCCCCTCAGACACCGTTACTGTAAGCTTGCAGGCCTCAGC
TGTGGCCACGGCAGGCCCGCTCTCTCAGGCCCTCAGGGTCAAGGCCTTGGTTGGACCTGC
CCACTCCAAAAACCCAGTGTGGGGGCAAAGGGCGTGGGAAGAGCAGGGCTTGCCCAGCGA
CACTGCTGGACAGGAATTAACTCTCCAAAGGTCTCCCCTGCTCCCTACCTAGGTTGGGGC
TTCATGGTTTCTGCTCAGTCTGTCCCCCTTCCCCCTCGACCCCCGCAATGAGTGGGCACC
AGGGGACGCTCTGGCGAGGGCAGACCCCAGGGGAAAGCAAAGGGCGTCTCAGGGAACCCC
CACATTCTCTCACTGAAGTTTCCCACCAGGATGACCCCACAGCCAGAGTCCCTTGGCAGC
CCCTCACCCCAGACCCCCCTTCTAAGGAAAAAGAGAGGTTCAGAGCGTTGGACCTTCATG
AACAGTGGCCTGGCTGGCGTGGCAGGGCCAAGGCCCACCCACTGCCATCCCCCTTCTGTG
TGTCCCTCTCCCCCAGTTATGAGGCCCAGGGCCTGAGCTCTCTTCCCCAGCATTGCCCCC
ACCCGGAAACCCCACCTTTGGAGAGTTAATTGTCTGTGTGAGGTGCTTAACCTATCAGCC
CTGAGAACACAAAGCAATAATCTTTGTTACTGAGATGCGCGGCTGTTCGTGTTTTGGGTT
TTTTTTTTTTTTAATGTTTCCTAATAAAAGAGAAGCTGCATTTTATTGGTTTTTATTTTT
AATTTTCTACACGTTTGAGCTGAGTCCTGAGACACTTAGCTTCCCTCTCCCTCATTCCCG
GACCCTTCCACCCCACTGGGCCCAACCATGGGCTCAGGACCCTGGAATTCCGTTTTCTGA
TTTGCTTTGGGATTTTTTTTTTTTTTAAGATGTTACATGGTGTTTCGAAGCCAGCAAGTT
ACCATCCTCCGGTGTCTCTTCTCTCCACATCTGTAACTTCTTTTTCCAGGTTTTATTTTC
AGTTTTAAATTCCTAATAAATTATTTGAAAACGTTAAAAAAAAAAAAAA

Protein Sequence

>4440 : length: 362
METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRS
RGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNT
TVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVE
CKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYT
YQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGST
PSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNG
YH