ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4357

Name

MPST

Synonym

MST|TST2|TUM1;mercaptopyruvate sulfurtransferase;MPST;mercaptopyruvate sulfurtransferase

Definition

3-mercaptopyruvate sulfurtransferase|human liver rhodanese|tRNA thiouridin modification protein 1

Position

22q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cysteine and methionine metabolism;KEGG PATHWAY;hsa00270

Pathway

Sulfur relay system;KEGG PATHWAY;hsa04122

Pathway

L-cysteine degradation III;BioCyc;PWY-5329

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

External Links

Links to cell senescence gene database

4357

Links to epithelial mesenchymal transition gene database

4357

Links to ovarian cancer gene database

4357

Links to endometrial cancer gene database

4357

Links to iHOP

4357

Sequence Information

Nucleotide Sequence

>4357 : length: 1547
GGCCGCGCGGGCCTGGGCTGGGCGGAGCGGGCGTACCCCCACGGCCCGGCCAGTGGAAGG
CGCGGGCAGCAGCGGCTCCGAGTGGCCGCGGCGGTGGGCTGTGCCGGAGTCTCCTCCCTT
TGGTCCGCTGCAGGTCGCCAATATAAATGCTTGATGAGTGAATGAATGACTTCCGTCTGG
GACTTGGTTGCAAATAAAGCCGAGCTGCATCTTAGGGAGGGGTGGAGACTTTGCCCCTGT
TTGTGCCTTGAAGCCAGCAGGGCCTTGCCCTAGGATACCTCCACCCACCCTCCTGCCCAG
CAAGTGGAGGCCCGCAGCCCGAGTGTCGCCGCCATGGCTTCGCCGCAGCTCTGCCGCGCG
CTGGTGTCGGCGCAATGGGTGGCGGAGGCGCTGCGGGCCCCGCGCGCTGGGCAGCCTCTG
CAGCTGCTGGACGCCTCCTGGTACCTGCCGAAGCTGGGGCGCGACGCGCGACGCGAGTTC
GAGGAGCGCCACATCCCGGGCGCCGCTTTCTTCGACATCGACCAGTGCAGCGACCGCACC
TCGCCCTACGACCACATGCTGCCCGGGGCCGAGCATTTCGCGGAGTACGCAGGCCGCCTG
GGCGTGGGCGCGGCCACCCACGTCGTGATCTACGACGCCAGCGACCAGGGCCTCTACTCC
GCCCCGCGCGTCTGGTGGATGTTCCGCGCCTTCGGCCACCACGCCGTGTCACTGCTTGAT
GGCGGCCTCCGCCACTGGCTGCGCCAGAACCTCCCGCTCAGCTCCGGCAAGAGCCAACCT
GCTCCCGCCGAGTTCCGCGCTCAGCTCGACCCCGCCTTCATCAAGACCTACGAGGACATC
AAGGAGAACCTGGAATCCCGGCGCTTCCAGGTGGTGGACTCCCGAGCCACTGGCAGGTTC
CGCGGCACCGAGCCCGAGCCCCGAGACGGCATTGAACCTGGCCACATCCCAGGTACCGTG
AACATCCCCTTCACAGACTTCCTGAGCCAGGAGGGGCTGGAGAAGAGCCCTGAGGAGATC
CGCCATCTGTTCCAGGAGAAGAAAGTGGACCTGTCTAAGCCACTGGTGGCCACGTGTGGC
TCTGGCGTCACAGCCTGCCACGTGGCACTAGGGGCCTACCTCTGCGGCAAGCCAGACGTG
CCCATCTACGATGGCTCCTGGGTGGAGTGGTACATGCGCGCCCGGCCCGAGGATGTCATC
TCAGAGGGCCGGGGGAAGACCCACTGAAGCTGGGCAGGACACAGGCGAGCTCAGGTGATG
CCGGCCACCAGCAATGCCTGGCCTGGTAGCTCCGCTTCTGCTTTCACCAAGAGAGTGTTT
CTTCACTCAACTCAGGTGGCATTTGGGGTGACATCTCAAAGGCCAGGAATTCCGTTGACT
TGTTGGCTGCCAGTAGGGGCGGGAGGAAAGGCGGAGGCGAGCCCTGGAGGAGGGAGGCCA
CAACTCCGAGCTGCCCACCTGGTGCTGAGCTGGGGCCCCGCCTCCTTTCTGTTTTATTTT
TGAGGAAATAAAATAACCAAGTGCTAAATCTTGTAAAAAAAAAAAAA

Protein Sequence

>4357 : length: 317
MAEPGSRESETRARSPSVAAMASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPK
LGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY
DASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDP
AFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQE
GLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWY
MRARPEDVISEGRGKTH