ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4342

Name

MOS

Synonym

MSV;v-mos Moloney murine sarcoma viral oncogene homolog;MOS;v-mos Moloney murine sarcoma viral oncogene homolog

Definition

c-mos|oncogene MOS, Moloney murine sarcoma virus|oocyte maturation factor mos|proto-oncogene c-Mos|proto-oncogene serine/threonine-protein kinase mos

Position

8q11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Disease

DEVELOPMENTAL;GAD

Disease

height;GAD

External Links

Links to cell senescence gene database

4342

Links to epithelial mesenchymal transition gene database

4342

Links to ovarian cancer gene database

4342

Links to endometrial cancer gene database

4342

Links to iHOP

4342

Sequence Information

Nucleotide Sequence

>4342 : length: 1041
ATGCCCTCGCCCCTGGCCCTACGCCCCTACCTCCGGAGCGAGTTTTCCCCATCGGTGGAC
GCGCGGCCCTGCAGCAGTCCCTCAGAGCTACCTGCGAAGCTGCTTCTGGGGGCCACTCTT
CCTCGGGCCCCGCGGCTGCCGCGCCGGCTGGCCTGGTGCTCCATTGACTGGGAGCAGGTG
TGCTTGCTGCAGAGGCTGGGAGCTGGAGGGTTTGGCTCGGTGTACAAGGCGACTTACCGC
GGTGTTCCTGTGGCCATAAAGCAAGTGAACAAGTGCACCAAGAACCGACTAGCATCTCGG
CGGAGTTTCTGGGCTGAGCTCAACGTAGCAAGGCTGCGCCACGATAACATCGTGCGCGTG
GTGGCTGCCAGCACGCGCACGCCCGCAGGGTCCAATAGCCTAGGGACCATCATCATGGAG
TTCGGTGGCAACGTCACTTTACACCAAGTCATCTATGGCGCCGCCGGCCACCCTGAGGGG
GACGCAGGGGAGCCTCACTGCCGCACTGGAGGACAGTTAAGTTTGGGAAAGTGTCTCAAG
TACTCACTAGATGTTGTGAACGGCCTGCTCTTCCTCCACTCGCAAAGCATTGTGCACTTG
GACCTGAAGCCCGCGAACATCTTGATCAGTGAGCAGGATGTCTGTAAAATTAGTGACTTC
GGTTGCTCTGAGAAGTTGGAAGATCTGCTGTGCTTCCAGACACCCTCTTACCCTCTAGGA
GGCACATACACCCACCGCGCCCCGGAGCTCCTGAAAGGAGAGGGCGTGACGCCTAAAGCC
GACATTTATTCCTTTGCCATCACTCTCTGGCAAATGACTACCAAGCAGGCGCCGTATTCG
GGGGAGCGGCAGCACATACTGTACGCGGTGGTGGCCTACGACCTGCGCCCGTCCCTCTCC
GCTGCCGTCTTCGAGGACTCGCTCCCCGGGCAGCGCCTTGGGGACGTCATCCAGCGCTGC
TGGAGACCCAGCGCGGCGCAGAGGCCGAGCGCGCGGCTGCTTTTGGTGGATCTCACCTCT
TTGAAAGCTGAACTCGGCTGA

Protein Sequence

>4342 : length: 346
MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQV
CLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG