ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4331

Name

MNAT1

Synonym

CAP35|MAT1|RNF66|TFB3;MNAT CDK-activating kinase assembly factor 1;MNAT1;MNAT CDK-activating kinase assembly factor 1

Definition

CDK-activating kinase assembly factor MAT1|CDK7/cyclin-H assembly factor|RING finger protein 66|RING finger protein MAT1|cyclin G1 interacting protein|cyclin-G1-interacting protein|menage a trois 1 (CAK assembly factor)|menage a trois homolog 1, cyclin H

Position

14q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

sonic hedgehog receptor ptc1 regulates cell cycle;PID BioCarta;100060

Pathway

mRNA Processing;Reactome;REACT:1675

Pathway

DNA Repair;Reactome;REACT:216

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

Transcription;Reactome;REACT:1788

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Nucleotide excision repair;KEGG PATHWAY;hsa03420

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Gene Expression;Reactome;REACT:71

Disease

Leukoencephalopathy;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Lung cancer;FunDO

External Links

Links to cell senescence gene database

4331

Links to epithelial mesenchymal transition gene database

4331

Links to ovarian cancer gene database

4331

Links to endometrial cancer gene database

4331

Links to iHOP

4331

Sequence Information

Nucleotide Sequence

>4331 : length: 1397
GCGAAGGGACCGTCTCTGCCAAGCGCCTGTTGGTAGGAACCTGCTTGGTCGCGTCTGAGG
GGGCTTGTAGGTGGCTCTGGCTGAAACAGGCGCCTGCGAGAGTCTGTAGGAGGGAAACCG
CCATGGACGATCAGGGTTGCCCTCGGTGTAAGACCACCAAATATCGGAACCCCTCCTTGA
AGCTGATGGTGAATGTGTGCGGACACACTCTCTGTGAAAGTTGTGTAGATTTACTGTTTG
TGAGAGGAGCTGGAAACTGCCCTGAGTGTGGTACTCCACTCAGAAAGAGCAACTTCAGGG
TACAACTCTTTGAAGATCCCACTGTTGACAAGGAGGTTGAGATCAGGAAAAAAGTGCTAA
AGATATACAATAAAAGGGAAGAAGATTTTCCTAGTCTAAGAGAATACAATGATTTCTTGG
AAGAAGTGGAAGAAATTGTTTTCAACTTGACCAACAATGTGGATTTGGACAACACCAAAA
AGAAAATGGAGATATACCAAAAGGAAAACAAAGATGTTATTCAGAAAAATAAATTAAAGC
TGACTCGAGAACAGGAAGAACTGGAAGAAGCTTTAGAAGTGGAACGACAGGAAAATGAAC
AAAGAAGATTATTTATACAAAAAGAAGAACAACTGCAGCAGATTCTAAAAAGGAAGAATA
AGCAGGCTTTTTTAGATGAGCTGGAGAGTTCTGATCTCCCTGTTGCTCTGCTTTTGGCTC
AGCATAAAGATAGATCTACCCAATTAGAAATGCAACTTGAGAAACCCAAACCTGTAAAAC
CAGTGACGTTTTCCACAGGCATCAAAATGGGTCAACATATTTCACTGGCACCTATTCACA
AGCTTGAAGAAGCTCTGTATGAATACCAGCCACTGCAGATAGAGACATATGGACCACATG
TTCCTGAGCTTGAGATGCTAGGAAGACTTGGGTATTTAAACCATGTCAGAGCTGCCTCAC
CACAGGACCTTGCTGGAGGCTATACTTCTTCTCTTGCTTGTCACAGAGCACTACAGGATG
CATTCAGTGGGCTTTTCTGGCAGCCCAGTTAACCATTTATAAGATTTGGACCTTGGAGCT
GAACCAGGGAGCTAGCAAAAGTAAAGCAGACTTATAAAATTATAGCTATGTGCAGCTGCA
CAACACAGTCCTTCCACTAGCAGCTGTGTTAAAGTATTTATAAGGAGAAAATTTCAGAAC
TAAGTTGAGTAATATAGGGGATATATATTTGTGAAAAATAATTTTTACTTATATTTTTCA
GAGGATTTGACACGATAAGCCTCATCTGATGGAAGAGAGGAATAAATAATTCACCTATAT
GTGTTTGAGGTTGTGACAGACTTATAAAATCTTTTTAAAAAATAAAGCTATAATTTATAT
TAAAAAAAAAAAAAAAA

Protein Sequence

>4331 : length: 309
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRV
QLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKK
KMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNK
QAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHK
LEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA
FSGLFWQPS