ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4330

Name

MN1

Synonym

MGCR|MGCR1|MGCR1-PEN|dJ353E16.2;meningioma (disrupted in balanced translocation) 1;MN1;meningioma (disrupted in balanced translocation) 1

Definition

meningioma (translocation balanced)|meningioma chromosome region 1|probable tumor suppressor protein MN1

Position

22q12.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4330

Links to epithelial mesenchymal transition gene database

4330

Links to ovarian cancer gene database

4330

Links to endometrial cancer gene database

4330

Links to iHOP

4330

Sequence Information

Nucleotide Sequence

>4330 : length: 7569
GCGCGGAGGCAGGGAACCGGAGCCTTGGAGCGACCCAACCCCTCGTCTCGCTGCCCTCCC
GCGCCTGCAACGGTGCGCGGAGACTCCGGCGAACTCAGACACCCAACGGCGGAGAACAGA
AGCGGCAGGCGGCGGACGTGGCCGCGAAGCTGCGCGCCGAACGCAGCGCACCCGCTGCCG
AGCAGAGGAGCCGCGCCTTTCCCCGACCCTCGGCTCCAGCCCCCGGCGCCTGCCGCCTCG
CAGCCCCTCTGCGTCCTCGGCTCGGGGGCCGGCACCGGCGATGCCGAGCGGAGCCTCCAG
TCCTCCGACCCGCTGAAGAAGCAGCAGCCGCTCGCCCGGAGCCTACGGGGATTGTGCGAG
CGGATCGTGCTCGGTGGAGGCTCGGGCTGCGGGGCGCGGGGACTCCGGGGGGCGGGGGGA
GGGACCGCTCTGTCGGTGCCCGGCGCCAGCCGCGGCTTTGAAGGGTCTCCCTCCCCTGCC
CTTAGCAGCTCTGCCACGGACTCCGGGAGGCTGCGGGCGGCGTCCTGAGGGCTCCCCAGC
AGACCCAATCGGACTTGAGAAGGTGATCGCTCTGCTCTCCCAACCCCCTTCCCTCCCCAT
TCCCCCCACTTAACTTTTTGTCTCCGTTCATCCGCGGCTTCGTCCCCTCCCCGCAGACCC
ACCCGCGGCTGTGACAACCGCCCGGGGCATGGGCCCCCCAACACGGCTCCTAGAGGCCCC
GCGGCCTCGCAAGATGTGAGAGGCCCTCCCCGGGCAGAATCGGAGCTTCAGGAGAGGAGC
TAATACCCCGCCCCCCGTCCCTCACATCAGGCGGGGTGGAGGTGCGCGCTGAGCCCCCGC
GGTGCTGAGCGTCCCGGAGCGCCCAATCCTGGGCTGGAACGAGTAGCTGGCCGGAGGCGC
GCCGCGGAGAGCCGGCTGTCATGCCCTATTGATCCCCCTCTGCCCCCCGCCAAGTATGTT
TGGGCTGGACCAATTCGAGCCCCAGGTCAACAGCAGGAACGCTGGCCAGGGCGAGAGGAA
CTTTAACGAGACCGGACTGAGCATGAACACCCACTTTAAGGCCCCGGCTTTCCACACTGG
GGGGCCCCCTGGCCCTGTGGATCCTGCTATGAGCGCGCTGGGCGAACCCCCGATCTTGGG
CATGAACATGGAGCCCTACGGCTTCCACGCGCGCGGCCACTCGGAGTTGCACGCAGGGGG
GCTGCAAGCGCAGCCTGTGCACGGCTTCTTTGGCGGCCAGCAGCCTCACCACGGCCACCC
GGGAAGTCATCATCCCCACCAGCATCACCCCCACTTTGGGGGCAACTTCGGTGGCCCGGA
CCCCGGGGCCTCGTGCCTGCACGGGGGTCGCCTGCTCGGCTACGGCGGCGCAGCCGGAGG
CCTGGGCAGCCAGCCGCCCTTCGCCGAGGGCTATGAGCACATGGCGGAGAGCCAGGGGCC
TGAGAGCTTCGGCCCGCAGCGACCGGGGAACCTCCCGGACTTCCACAGTTCAGGTGCCTC
CAGCCACGCCGTGCCGGCCCCATGCCTGCCGCTGGACCAGAGCCCTAACCGAGCCGCCTC
CTTCCACGGCCTGCCGTCCTCCAGCGGCTCCGATTCCCACAGTCTGGAGCCACGGAGGGT
GACGAACCAAGGAGCCGTCGACTCGCTGGAATACAATTACCCGGGCGAGGCGCCCTCGGG
ACATTTTGACATGTTTTCGCCCTCTGACTCCGAAGGGCAGCTGCCTCATTATGCAGCGGG
TCGCCAGGTTCCTGGGGGCGCTTTCCCGGGCGCCTCGGCCATGCCCAGAGCTGCGGGCAT
GGTGGGCTTGTCCAAAATGCACGCCCAGCCACCGCAGCAGCAGCCCCAGCAGCAGCAGCA
GCCCCAGCAGCAGCAGCAGCAGCATGGTGTGTTCTTTGAGAGGTTCAGTGGGGCCAGAAA
GATGCCTGTGGGTCTGGAGCCCTCAGTGGGCTCCAGGCACCCGTTAATGCAGCCTCCCCA
GCAGGCCCCGCCACCCCCTCAGCAGCAGCCCCCGCAGCAGCCGCCACAGCAGCAGCCGCC
GCCGCCACCCGGGCTTCTAGTCCGACAAAATTCGTGCCCGCCTGCGCTCCCTCGGCCCCA
GCAGGGCGAGGCGGGCACGCCCAGCGGCGGCCTGCAGGACGGAGGCCCCATGCTGCCCAG
CCAGCACGCGCAATTCGAGTATCCCATCCACCGGCTGGAGAACCGGAGCATGCACCCTTA
TTCCGAGCCTGTTTTCAGCATGCAGCATCCTCCTCCGCAGCAGGCGCCCAACCAGCGGCT
GCAGCATTTCGACGCGCCCCCCTACATGAACGTGGCCAAGAGGCCGCGCTTCGACTTTCC
GGGCAGCGCGGGAGTGGACCGCTGCGCTTCGTGGAACGGCAGCATGCACAACGGCGCTCT
GGATAATCACCTCTCCCCTTCCGCCTACCCAGGCCTACCCGGCGAGTTCACACCGCCTGT
GCCCGACAGCTTCCCTTCGGGGCCGCCCCTGCAGCATCCGGCCCCGGACCACCAGTCCCT
GCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAACAGCA
ACAGCAACAGCAGCAGCAGCAGCAGCGCCAAAACGCGGCCCTCATGATTAAGCAGATGGC
GTCGCGGAATCAGCAGCAGCGGCTGCGCCAGCCCAACCTGGCTCAGCTAGGCCACCCCGG
GGACGTGGGCCAGGGCGGCCTGGTGCATGGCGGCCCGGTGGGCGGCTTGGCCCAGCCGAA
CTTTGAGCGCGAAGGCGGCAGCACGGGCGCCGGGCGTCTGGGCACCTTCGAGCAGCAGGC
GCCGCACTTGGCGCAAGAGAGCGCGTGGTTCTCAGGTCCGCATCCGCCGCCCGGAGACCT
GCTGCCCCGTAGGATGGGCGGCTCGGGTCTGCCCGCTGACTGTGGCCCGCACGACCCCAG
CCTGGCGCCCCCTCCTCCGCCTGGTGGCTCGGGGGTGCTGTTCCGGGGCCCTCTGCAGGA
GCCGATGAGGATGCCCGGAGAGGGCCACGTGCCCGCGCTGCCTTCACCGGGCCTGCAGTT
CGGGGGCAGTCTGGGAGGCCTGGGTCAGCTGCAGTCGCCCGGGGCGGGCGTGGGGCTCCC
CAGCGCTGCTTCGGAGCGCCGGCCCCCGCCGCCGGACTTTGCTACGTCTGCGCTCGGGGG
CCAGCCGGGCTTTCCGTTTGGTGCAGCCGGCCGGCAGTCCACGCCGCACAGCGGTCCAGG
CGTGAACTCGCCCCCCAGCGCGGGAGGGGGCGGTGGCAGCTCTGGTGGCGGCGGTGGCGG
GGGTGCCTACCCGCCGCAGCCTGATTTCCAGCCCAGCCAGCGCACCTCGGCCAGTAAATT
GGGCGCGCTCTCGCTGGGCTCCTTCAACAAGCCCAGCTCCAAGGACAACCTGTTCGGCCA
GAGCTGCCTGGCTGCGCTCTCCACCGCTTGCCAGAACATGATCGCCAGCCTCGGGGCCCC
CAACCTCAACGTGACCTTCAACAAGAAGAACCCGCCAGAGGGCAAGAGGAAACTGAGCCA
GAACGAGACCGACGGCGCGGCAGTGGCCGGCAACCCGGGCTCGGATTACTTCCCAGGAGG
GACTGCTCCTGGGGCCCCAGGACCCGGAGGCCCGTCCGGGACCAGTAGCAGCGGCTCCAA
AGCCTCGGGGCCGCCCAACCCTCCAGCCCAGGGGGACGGCACCAGCCTCTCCCCCAACTA
CACCCTGGAATCCACGTCGGGGAATGACGGCAAGCCGGTCTCCGGGGGCGGCGGCCGGGG
ACGGGGTCGCAGAAAAAGGGACAGTGGTCACGTGAGCCCTGGCACCTTCTTTGACAAGTA
CTCGGCGGCTCCGGACAGCGGGGGCGCACCTGGGGTGAGCCCAGGGCAGCAGCAAGCGTC
AGGCGCAGCCGTCGGGGGAAGCTCCGCAGGCGAGACGCGCGGGGCACCGACGCCCCACGA
AAAGGCGCTCACGTCGCCATCCTGGGGGAAGGGGGCTGAGTTGCTCCTGGGGGATCAGCC
GGACCTCATTGGGTCCCTGGACGGCGGGGCCAAGTCGGACAGTAGTTCGCCAAACGTGGG
TGAGTTCGCCTCGGACGAGGTGAGCACGAGCTACGCCAATGAGGACGAGGTGTCGTCCAG
CTCTGACAACCCCCAGGCACTAGTTAAAGCGAGCAGGAGTCCCCTGGTGACCGGCTCGCC
CAAACTCCCTCCCCGTGGGGTAGGCGCCGGGGAACACGGACCGAAGGCGCCCCCGCCCGC
CCTCGGCCTGGGCATCATGTCTAACTCTACCTCGACCCCTGACAGCTACGGCGGCGGTGG
GGGCCCGGGCCATCCGGGCACTCCGGGCCTGGAGCAGGTCCGCACCCCGACGAGCAGCAG
CGGCGCCCCGCCACCCGACGAGATCCACCCCCTGGAGATCCTTCAGGCGCAGATCCAGCT
ACAGAGGCAGCAGTTCAGCATCTCCGAGGACCAGCCTCTGGGGCTGAAGGGTGGCAAGAA
GGGTGAGTGCGCCGTCGGGGCCTCAGGGGCGCAGAATGGCGACAGCGAGCTGGGCAGCTG
CTGCTCCGAGGCGGTCAAGAGCGCCATGAGCACCATTGACCTGGACTCGCTGATGGCAGA
GCACAGCGCTGCCTGGTACATGCCCGCTGACAAGGCCCTGGTGGACAGCGCGGACGACGA
CAAGACGTTGGCGCCCTGGGAGAAGGCCAAACCCCAGAACCCCAACAGCAAAGAAGCCCA
CGACCTCCCTGCAAACAAGGCCTCAGCATCCCAGCCTGGCAGCCACTTGCAGTGCCTGTC
TGTCCACTGCACAGACGACGTGGGTGACGCCAAGGCTCGAGCCTCCGTGCCCACCTGGCG
GTCCCTGCATTCTGACATCTCCAACAGATTTGGGACATTCGTGGCTGCCCTAACTTGAAT
GACAAGAAAGATCCCCTCCTCTACCAGGCCCTTCCTCTCCCCCTGTCTGTTTCCTTCCCC
CTCAACCTTACCCCACCCCTCTGTTAATTTGAAAGGGCCACTATTGCTGAGTGGATGAGT
TTTTTTTTTTTCTCTAGGTTGGTACCTGCTTAGTGGCATATGGACCGGAAAGGGTTAATT
TAAAGGGGGGGAACCTCAAAAGTTTTTTTAAAAAAGAAACTTGTCTGCCACAGTATGTTA
CCAGTGTTAACCCTTCTGCAGTTAGCAAACTTTTGCTTAAGCCTTTTTCCTCTAGATACT
CCCCATGTTTCGGTAATCTTGGCATACATTTTTTAGATGACCTCTTTCCTTGTTTTGTTT
TCATGCTGCTGTATGTCCAAGTATTGTTATTTCATAATAAGACAAGAGTTGCTTTCTTTT
TTATTCTTTTTCCTTTTCTTACCCCCTCCCCTTTTATTTTCTTTTTGCTTTGTTCACTGC
TTATTAAAATGGAAATCCTGGAGAATAGTAGTTCTGGAATATTGCCGGGTGAAAGTCCAA
TTGTCATCACAATGTTATATATTGACACCCCAGTGTCATCAGTCAGGCAGGAGCCAAACA
ATGAATGCCCCTCTTAGGTATTCCGCCTGGGATTTTGTTTTGTCTGTTCCCTAAGAAAAT
ATATTTTCATTCCTGCAAACACAGTGCTCAGCCTTCAGTTCCCTTCCACTTGAGTTCTCT
CTTCTCCTGCTGGAAGCCGCCCCTCTCTGCGATGGACGTGAGGACGTGTCCAGCTCTGCT
CTGTGGGAAGGAGTTGGAATGTTCGACAGCAGTGTTTTCTCTCCTTTTCTGGGCCTCCTC
GCAAATGCCCAGGCCCTGCATTTTCACGCTGTGCTAAGCAGCCTTTGGTCTGCATGGGGG
ATGGTGTGCTCCCAGCCTGCAGTCTTTGGAGCAAGGCTGCTGCCCGTGCCTTGGGTGCTG
GAGTTGGAGGAGGCTGTTCTCAGCCCTTTCCCTTTTCTGAAAGCTGTTCCTGGCCGGGCA
TCCCAGGGAAGAAGGAGGGGACTGCGTGTATCTCCTCCACCTCTCCCATTCCATCCCCAG
TCCAGCCTGGGCAACCCCACCCCTGGGAGGGATGAGGCACCCTCTTGCTCAGCCTGCTCA
GCCTTCTCTGAGCCTTTGCAGGGATCTGCAGACTCCTGAGGGCTAGAGGACAGAGAAAGA
GAATAGAATGAAATGACTTTGATTCCTGCGCCTTTTAGTTTTGAACTCTGGAATTCCTCT
GCCCCCTCCCCAACATTTTTTTGGAATCTCACCCTGTTGCAAAACTAGAGCCATGTCCCA
AGCATCTCACAAAGGAATAACTGCTCTGAGCAGAGATGAGTGGTGGTTGGCAGGGGCAGG
CAACTTTGGGTGCTGCTGATGCCTGCAAAAGCCATTTATGGCTTGTGGTGGGGGGCACAT
AGATTCCCCGGTGGGTTAGACAGGAAGTAACTGATATCACTTCACCCAAATATATAACCG
TGATGGTTATCTATTTAATTTCAGTTTTTGTTAACGAGCGTGTCTTACTAAAACGCTCCA
CTTTGAGCTCCCCCACCCCCTCCAGGTCCTCAGAGTTTGCAGATCTGGGCTTTCTAAAGC
AAGTGACCTGAAGGCTCTGGGCTCACCATACAACACCCACGTTGTTTATTTCAAAGAACT
TTTCAGCGAAGGGAGAGGAGCTTTCAGAAAAACCTCACTCTTTCCCCTCCCTTCTCCCCT
CTTTCCTTCTGCCGGTCCTTTTGGCTGGGGTCTGAGTCTGCGGTTCTCGCCTGGGCAGTC
TTGACGAGGAGCAAACCCCGCCTTCAGAGGGCAGACAAAGCAGGTGGCATGAATTGATCA
GCGAGAAAGGTGTGAGCCGAGGCAGTTCCTGCGTTCTGCTACAAAAGGAATGGAAAGGGA
AGGGAATTTCCCCCCACCATGGGCTGTGGGAGAGTTGACCGTATTCTGGGCAAGACTCCA
TGACCCCTCTGATTCTGCAGTGTACAGCTGTTTGAGAGCCTCATCATTTTACTTTTGAAA
CAGGAATGATTTCTCCTTAATTGCTTAAGGCCGGGGAGCAAAGTGTCTTAACTTCTGTCT
TTGACTTTCCCAGCGTTGAGTCATCAACACTTTGCCAATTAGCTCATGGTCCTGGCAACC
TCAGAAACCCCTGAAGTTTTAAAAACTTTCTCGCTCCCCACGACCCCAGAATGAAACAGC
TTTAAAAATAGCCTTAAGCAAAAGGATGTTATTTCATTAAATTTGGTTTAATGGAAAGAA
TAAAAGTAAATGAAAAACACACCCTACACACTAGACTCCGAACACTGGTAATCAGTACTG
CATAGCAAACTCTTTGGGAAAGAAAACGAAAATGTTATTGCACATGTAAAATATGAAAAC
TTAACTCTGCTGTGTGTTAGGCAATCCTGTAATCTTTTTTGACTCTTAAAAGAAATTCAT
TTCTGAAATGCTTGGTTGGAAGACTGTGACAATAGCTCATGAAATTGAGTGTTATTTTTT
TCTTTCTTTTTTAAAAAAATATGTAAAGTGCAGTCTTCTGTATTCCTGCATATTGTATAT
ACCTGTATATGTTTTCCTGAGCAGTTAAATAACAATAAATATGACGTTAATGGTGAAAAA
AAAAAAAAA

Protein Sequence

>4330 : length: 1320
MFGLDQFEPQVNSRNAGQGERNFNETGLSMNTHFKAPAFHTGGPPGPVDPAMSALGEPPI
LGMNMEPYGFHARGHSELHAGGLQAQPVHGFFGGQQPHHGHPGSHHPHQHHPHFGGNFGG
PDPGASCLHGGRLLGYGGAAGGLGSQPPFAEGYEHMAESQGPESFGPQRPGNLPDFHSSG
ASSHAVPAPCLPLDQSPNRAASFHGLPSSSGSDSHSLEPRRVTNQGAVDSLEYNYPGEAP
SGHFDMFSPSDSEGQLPHYAAGRQVPGGAFPGASAMPRAAGMVGLSKMHAQPPQQQPQQQ
QQPQQQQQQHGVFFERFSGARKMPVGLEPSVGSRHPLMQPPQQAPPPPQQQPPQQPPQQQ
PPPPPGLLVRQNSCPPALPRPQQGEAGTPSGGLQDGGPMLPSQHAQFEYPIHRLENRSMH
PYSEPVFSMQHPPPQQAPNQRLQHFDAPPYMNVAKRPRFDFPGSAGVDRCASWNGSMHNG
ALDNHLSPSAYPGLPGEFTPPVPDSFPSGPPLQHPAPDHQSLQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQRQNAALMIKQMASRNQQQRLRQPNLAQLGHPGDVGQGGLVHGGPVGGLAQ
PNFEREGGSTGAGRLGTFEQQAPHLAQESAWFSGPHPPPGDLLPRRMGGSGLPADCGPHD
PSLAPPPPPGGSGVLFRGPLQEPMRMPGEGHVPALPSPGLQFGGSLGGLGQLQSPGAGVG
LPSAASERRPPPPDFATSALGGQPGFPFGAAGRQSTPHSGPGVNSPPSAGGGGGSSGGGG
GGGAYPPQPDFQPSQRTSASKLGALSLGSFNKPSSKDNLFGQSCLAALSTACQNMIASLG
APNLNVTFNKKNPPEGKRKLSQNETDGAAVAGNPGSDYFPGGTAPGAPGPGGPSGTSSSG
SKASGPPNPPAQGDGTSLSPNYTLESTSGNDGKPVSGGGGRGRGRRKRDSGHVSPGTFFD
KYSAAPDSGGAPGVSPGQQQASGAAVGGSSAGETRGAPTPHEKALTSPSWGKGAELLLGD
QPDLIGSLDGGAKSDSSSPNVGEFASDEVSTSYANEDEVSSSSDNPQALVKASRSPLVTG
SPKLPPRGVGAGEHGPKAPPPALGLGIMSNSTSTPDSYGGGGGPGHPGTPGLEQVRTPTS
SSGAPPPDEIHPLEILQAQIQLQRQQFSISEDQPLGLKGGKKGECAVGASGAQNGDSELG
SCCSEAVKSAMSTIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKE
AHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT