ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4321

Name

MMP12

Synonym

HME|ME|MME|MMP-12;matrix metallopeptidase 12;MMP12;matrix metallopeptidase 12

Definition

macrophage metalloelastase|matrix metallopeptidase 12 (macrophage elastase)|matrix metalloproteinase 12 (macrophage elastase)

Position

11q22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Disease

Endometrial cancer;FunDO

Disease

gastric cardia adenocarcinoma and esophageal squamous cell carcinoma;GAD

Disease

Emphysema;FunDO

Disease

Prostate cancer;FunDO

Disease

Malignant glioma;FunDO

Disease

IMMUNE;GAD

Disease

Lung cancer;FunDO

Disease

Multiple sclerosis;FunDO

Disease

Periodontitis;FunDO

Disease

bladder cancer;GAD

Disease

CANCER;GAD

Disease

CARDIOVASCULAR;GAD

Disease

coronary artery luminal dimensions;GAD

Disease

lung cancer;GAD

Disease

rheumatoid arthritis;GAD

Disease

lung function;GAD

Disease

Endometriosis;FunDO

Disease

Atherosclerosis;FunDO

Disease

Cervical cancer;FunDO

Disease

Chronic obstructive airway disease;FunDO

Disease

Actinic keratosis;FunDO

External Links

Links to cell senescence gene database

4321

Links to epithelial mesenchymal transition gene database

4321

Links to ovarian cancer gene database

4321

Links to endometrial cancer gene database

4321

Links to iHOP

4321

Sequence Information

Nucleotide Sequence

>4321 : length: 1877
CAGAACCCGGACTAAGGGCTATATAAAGAGGAACAGTTCAGGAACTTAGGCTAGAAAGGA
ACACAGTAAACTGAATTGATCCGTTTAGAAGTTTACAATGAAGTTTCTTCTAATACTGCT
CCTGCAGGCCACTGCTTCTGGAGCTCTTCCCCTGAACAGCTCTACAAGCCTGGAAAAAAA
TAATGTGCTATTTGGTGAAAGATACTTAGAAAAATTTTATGGCCTTGAGATAAACAAACT
TCCAGTGACAAAAATGAAATATAGTGGAAACTTAATGAAGGAAAAAATCCAAGAAATGCA
GCACTTCTTGGGTCTGAAAGTGACCGGGCAACTGGACACATCTACCCTGGAGATGATGCA
CGCACCTCGATGTGGAGTCCCCGATGTCCATCATTTCAGGGAAATGCCAGGGGGGCCCGT
ATGGAGGAAACATTATATCACCTACAGAATCAATAATTACACACCTGACATGAACCGTGA
GGATGTTGACTACGCAATCCGGAAAGCTTTCCAAGTATGGAGTAATGTTACCCCCTTGAA
ATTCAGCAAGATTAACACAGGCATGGCTGACATTTTGGTGGTTTTTGCCCGTGGAGCTCA
TGGAGACTTCCATGCTTTTGATGGCAAAGGTGGAATCCTAGCCCATGCTTTTGGACCTGG
ATCTGGCATTGGAGGGGATGCACATTTCGATGAGGACGAATTCTGGACTACACATTCAGG
AGGCACAAACTTGTTCCTCACTGCTGTTCACGAGATTGGCCATTCCTTAGGTCTTGGCCA
TTCTAGTGATCCAAAGGCCGTAATGTTCCCCACCTACAAATATGTTGACATCAACACATT
TCGCCTCTCTGCTGATGACATACGTGGCATTCAGTCCCTGTATGGAGACCCAAAAGAGAA
CCAACGCTTGCCAAATCCTGACAATTCAGAACCAGCTCTCTGTGACCCCAATTTGAGTTT
TGATGCTGTCACTACCGTGGGAAATAAGATCTTTTTCTTCAAAGACAGGTTCTTCTGGCT
GAAGGTTTCTGAGAGACCAAAGACCAGTGTTAATTTAATTTCTTCCTTATGGCCAACCTT
GCCATCTGGCATTGAAGCTGCTTATGAAATTGAAGCCAGAAATCAAGTTTTTCTTTTTAA
AGATGACAAATACTGGTTAATTAGCAATTTAAGACCAGAGCCAAATTATCCCAAGAGCAT
ACATTCTTTTGGTTTTCCTAACTTTGTGAAAAAAATTGATGCAGCTGTTTTTAACCCACG
TTTTTATAGGACCTACTTCTTTGTAGATAACCAGTATTGGAGGTATGATGAAAGGAGACA
GATGATGGACCCTGGTTATCCCAAACTGATTACCAAGAACTTCCAAGGAATCGGGCCTAA
AATTGATGCAGTCTTCTACTCTAAAAACAAATACTACTATTTCTTCCAAGGATCTAACCA
ATTTGAATATGACTTCCTACTCCAACGTATCACCAAAACACTGAAAAGCAATAGCTGGTT
TGGTTGTTAGAAATGGTGTAATTAATGGTTTTTGTTAGTTCACTTCAGCTTAATAAGTAT
TTATTGCATATTTGCTATGTCCTCAGTGTACCACTACTTAGAGATATGTATCATAAAAAT
AAAATCTGTAAACCATAGGTAATGATTATATAAAATACATAATATTTTTCAATTTTGAAA
ACTCTAATTGTCCATTCTTGCTTGACTCTACTATTAAGTTTGAAAATAGTTACCTTCAAA
GGCCAAGAGAATTCTATTTGAAGCATGCTCTGTAAGTTGCTTCCTAACATCCTTGGACTG
AGAAATTATACTTACTTCTGGCATAACTAAAATTAAGTATATATATTTTGGCTCAAATAA
AATTGAAAAAAAAATCA

Protein Sequence

>4321 : length: 470
MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLM
KEKIQEMQHFLGLKVTGQLDTSTLEMMHAPRCGVPDVHHFREMPGGPVWRKHYITYRINN
YTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGI
LAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTY
KYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFF
FKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRP
EPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITK
NFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC