ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4301

Name

MLLT4

Synonym

AF6;myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4;MLLT4;myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4

Definition

ALL1-fused gene from chromosome 6 protein|afadin|protein AF-6

Position

6q27

Gene Type

protein-coding

Pathways and Diseases

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Disease

Breast cancer;FunDO

External Links

Links to cell senescence gene database

4301

Links to epithelial mesenchymal transition gene database

4301

Links to ovarian cancer gene database

4301

Links to endometrial cancer gene database

4301

Links to iHOP

4301

Sequence Information

Nucleotide Sequence

>4301 : length: 7771
GGCGGGGCTGAGGCGGCGCGGCGCGGCGCGGACTGAGCCCCAGGCGGAGGCCAAGTCGGA
GGACGCGGCGCGGCCGCGGAGGCGGAGGCAGCCGCGGAGGCGGAGGCGGCCGGCGGGGGG
TGGCGAGGGGCGCCGGGCCCCCGCGGACCTGTCGTCCTCGGCCCGTCCTCCGGCCCCGGC
CCCGCGCGGCTGAGGAGGCGCGGCCAGGACCATGTCGGCGGGCGGCCGTGACGAGGAGCG
GCGGAAGCTGGCCGACATCATCCACCACTGGAACGCCAACCGGCTGGACCTGTTCGAGAT
CAGCCAGCCGACCGAGGATTTGGAGTTCCATGGAGTGATGAGATTTTATTTTCAAGATAA
AGCTGCTGGAAACTTTGCAACAAAATGTATTCGGGTCTCTAGTACTGCCACCACTCAAGA
TGTAATCGAAACGCTCGCGGAGAAATTTCGACCTGATATGCGAATGCTGTCCTCTCCCAA
GTATTCACTCTATGAAGTGCATGTCAGCGGAGAAGAAAGAAGATTGGATATAGATGAGAA
ACCTCTAGTTGTACAACTGAATTGGAACAAAGATGATCGGGAAGGCAGATTTGTTCTTAA
GAATGAGAATGACGCCATTCCTCCTAAGAAGGCTCAAAGTAATGGACCTGAAAAGCAGGA
AAAAGAAGGGGTTATCCAGAACTTCAAGAGAACTCTCTCAAAGAAAGAAAAGAAGGAAAA
AAAGAAGAGAGAAAAAGAGGCATTGCGACAGGCATCTGATAAAGATGATAGACCTTTCCA
AGGGGAGGATGTTGAAAATTCTCGACTGGCTGCTGAGGTTTACAAAGACATGCCGGAAAC
CAGCTTTACTCGAACCATTTCTAATCCTGAGGTGGTTATGAAACGACGGAGGCAGCAAAA
ATTGGAAAAGAGAATGCAGGAATTTCGGAGCTCAGATGGGCGGCCTGATTCAGGTGGAAC
ATTGAGAATTTATGCAGATAGTTTAAAACCAAATATTCCCTACAAGACAATCCTGCTGTC
TACTACAGATCCTGCAGACTTTGCTGTGGCTGAAGCTTTAGAGAAGTATGGTCTGGAAAA
AGAAAACCCTAAGGATTACTGCATCGCCCGGGTTATGCTTCCTCCTGGAGCCCAGCATTC
TGATGAAAAGGGTGCTAAAGAAATTATTCTTGATGATGATGAGTGTCCTTTACAAATCTT
CAGGGAATGGCCAAGTGACAAAGGGATTTTAGTCTTTCAGTTGAAGAGGAGGCCACCAGA
CCACATCCCAAAGAAAACCAAGAAACACTTGGAAGGCAAGACACCCAAGGGAAAGGAGAG
AGCTGACGGGTCTGGCTATGGCTCCACCCTTCCTCCGGAGAAGCTGCCCTATTTAGTAGA
GTTAAGCCCAGGGAGAAGGAATCACTTTGCCTACTACAACTATCACACTTACGAAGATGG
TTCTGACTCTAGAGATAAGCCAAAGCTTTACCGCCTTCAGTTAAGTGTTACTGAAGTTGG
GACAGAAAAGTTGGATGACAACTCTATCCAGTTGTTTGGCCCAGGAATTCAGCCCCATCA
CTGTGACCTTACCAACATGGATGGAGTGGTCACTGTGACGCCCAGAAGTATGGACGCAGA
AACCTACGTGGAAGGCCAGCGCATCTCAGAAACCACCATGCTGCAGAGTGGCATGAAAGT
GCAGTTTGGGGCGTCCCATGTATTTAAGTTTGTGGACCCCAGTCAGGATCATGCTCTTGC
AAAAAGATCTGTGGATGGAGGCCTGATGGTTAAGGGCCCAAGACATAAACCTGGAATTGT
TCAGGAGACAACTTTTGATTTGGGAGGAGATATTCATAGTGGGACAGCATTACCGACAAG
CAAGAGCACCACTAGGCTGGACAGCGACAGAGTGTCGTCTGCCTCTAGCACAGCCGAGCG
GGGAATGGTGAAGCCGATGATCAGAGTAGAACAGCAGCCAGATTATCGCAGGCAAGAAAG
CAGAACACAGGATGCTTCTGGGCCTGAGCTGATACTACCTGCAAGCATTGAATTCAGGGA
AAGTTCTGAAGATTCATTTTTGTCTGCCATTATAAATTATACTAATAGCTCTACAGTCCA
CTTTAAGTTGTCCCCTACATATGTATTATATATGGCATGCCGGTATGTATTGTCCAACCA
GTACAGACCTGACATCAGCCCTACAGAGCGCACACATAAAGTCATTGCAGTCGTCAACAA
GATGGTGAGCATGATGGAGGGTGTCATCCAGAAACAGAAGAATATTGCAGGGGCACTTGC
CTTCTGGATGGCAAATGCATCTGAACTTCTCAACTTCATTAAGCAAGACCGAGACCTTAG
TCGGATCACACTGGATGCTCAAGATGTTTTAGCACATTTGGTTCAAATGGCATTTAAATA
CTTGGTTCACTGTCTTCAATCAGAACTTAATAATTACATGCCAGCCTTTCTAGATGACCC
TGAAGAGAACAGTCTGCAACGACCAAAAATAGATGATGTGCTGCACACGCTCACAGGAGC
CATGTCCTTGCTACGACGCTGCAGAGTCAATGCCGCCCTGACCATCCAGCTCTTCTCTCA
GCTCTTCCACTTCATCAATATGTGGCTGTTCAATAGATTGGTGACCGACCCAGATTCGGG
GCTGTGCTCCCATTACTGGGGTGCGATTATCCGTCAGCAGTTGGGCCATATTGAAGCCTG
GGCTGAGAAGCAGGGGCTGGAACTGGCTGCGGACTGTCATCTGAGCAGGATCGTGCAGGC
AACGACTTTGCTTACCATGGATAAGTATGCACCTGATGACATTCCAAATATAAACAGCAC
CTGCTTTAAGTTAAATTCATTACAACTTCAAGCCTTATTACAGAACTATCACTGTGCACC
TGATGAGCCTTTTATCCCAACGGATCTTATAGAAAATGTAGTGACTGTGGCTGAAAACAC
TGCCGATGAGCTGGCCCGCAGTGATGGAAGGGAAGTGCAGTTGGAGGAGGATCCTGATCT
GCAGCTGCCGTTTCTTTTGCCAGAAGATGGTTATTCTTGTGATGTTGTCAGAAACATTCC
AAATGGTTTACAAGAATTTTTAGACCCTCTGTGCCAGAGAGGATTTTGCAGGTTAATTCC
TCACACACGTTCACCAGGTACTTGGACAATATATTTTGAAGGTGCAGATTATGAAAGTCA
CCTTCTGCGTGAGAACACAGAGCTGGCTCAGCCTCTGAGGAAAGAACCTGAAATAATCAC
TGTGACCCTAAAAAAGCAGAATGGAATGGGCCTTAGCATTGTTGCAGCAAAGGGTGCTGG
TCAAGATAAACTAGGAATCTATGTGAAGTCGGTTGTGAAAGGAGGTGCTGCAGATGTGGA
TGGACGTCTAGCTGCAGGTGATCAGCTCCTCAGTGTGGATGGACGAAGTCTGGTTGGACT
CTCTCAGGAAAGGGCGGCAGAACTCATGACAAGAACAAGCTCTGTGGTGACACTGGAAGT
AGCAAAGCAGGGTGCCATCTACCACGGTCTGGCCACCCTTCTCAATCAGCCATCCCCCAT
GATGCAGAGAATTTCAGATCGTCGTGGCTCAGGTAAACCCCGACCAAAGAGTGAAGGCTT
TGAGCTCTATAATAATTCAACTCAAAATGGGTCTCCTGAGAGTCCTCAGCTGCCTTGGGC
AGAATATAGTGAACCAAAGAAATTGCCTGGTGATGACAGACTGATGAAAAATAGAGCTGA
TCACCGTTCCAGCCCCAACGTAGCAAATCAGCCTCCTAGTCCTGGAGGGAAAAGTGCATA
TGCCTCTGGAACAACAGCGAAGATAACATCTGTCTCTACTGGAAACCTCTGCACTGAGGA
GCAGACGCCTCCGCCTAGACCTGAAGCCTACCCCATCCCCACTCAGACGTACACCAGAGA
GTATTTTACCTTCCCAGCTTCCAAATCCCAGGATCGGATGGCTCCTCCTCAGAACCAGTG
GCCAAATTATGAGGAAAAGCCACATATGCACACAGATAGTAATCATTCCAGTATTGCAAT
TCAGCGTGTTACACGTTCCCAAGAAGAACTTCGAGAAGATAAAGCTTACCAACTTGAGCG
GCATCGAATAGAGGCAGCTATGGACCGAAAGTCTGATAGTGATATGTGGATAAATCAGAG
CTCCTCACTGGACTCCAGTACCTCTAGCCAGGAGCATCTGAACCATTCCTCTAAGTCGGT
CACCCCTGCTTCCACACTGACCAAAAGTGGCCCTGGCCGTTGGAAAACACCAGCAGCCAT
ACCGGCCACCCCTGTGGCCGTCTCCCAGCCAATCCGAACAGACCTGCCTCCGCCACCCCC
GCCACCTCCAGTCCACTATGCCGGTGATTTCGATGGAATGTCCATGGATTTGCCTCTCCC
ACCACCCCCTTCCGCCAACCAGATAGGGCTGCCGTCTGCGCAGGTGGCTGCTGCTGAACG
GAGAAAGAGAGAAGAACATCAGCGTTGGTATGAGAAGGAGAAGGCCCGCCTGGAGGAGGA
GCGGGAGAGGAAGCGGAGAGAGCAGGAGAGGAAGTTGGGCCAGATGCGCACTCAGTCCTT
AAACCCTGCTCCGTTTTCTCCCCTGACTGCACAGCAGATGAAGCCCGAAAAGCCTTCCAC
ACTCCAGCGGCCACAGGAAACAGTCATTCGGGAGCTGCAGCCTCAGCAGCAGCCCCGCAC
GATCGAGCGCAGAGACTTGCAGTACATTACAGTCAGCAAAGAGGAGCTTTCCTCGGGGGA
CAGTCTGTCCCCCGACCCGTGGAAGCGGGACGCCAAGGAGAAGCTGGAGAAGCAGCAGCA
GATGCACATCGTGGACATGCTGAGCAAGGAGATCCAGGAGCTCCAGAGCAAACCGGACCG
CAGCGCCGAGGAGAGCGACCGGCTGCGCAAGCTCATGCTGGAGTGGCAGTTCCAGAAGAG
ACTCCAGGAGTCGAAGCAGAAGGACGAAGATGACGAGGAGGAGGAGGACGATGATGTGGA
CACCATGCTGATCATGCAGCGCCTGGAGGCTGAACGAAGAGCGAGGGACGAGGAGCGGAG
GCGGCAGCAGCAGTTAGAAGAGATGCGCAAGCGGGAAGCGGAAGACCGAGCGAGGCAAGA
GGAAGAGCGCCGGCGGCAGGAGGAGGAGCGAACAAAACGAGACGCTGAAGAAAAGAGGCG
ACAGGAAGAAGGGTATTACAGCCGCCTGGAAGCCGAGAGGCGCAGACAGCACGACGAGGC
GGCGCGCAGGTTGCTGGAGCCCGAGGCGCCCGGTCTGTGCCGCCCTCCGCTTCCCCGGGA
CTACGAGCCCCCGTCCCCGTCCCCCGCGCCCGGCGCCCCTCCTCCCCCGCCTCAGCGAAA
CGCCTCCTACCTCAAAACACAGGTCCTCTCCCCCGACTCGCTGTTCACTGCCAAGTTTGT
TGCATACAATGAGGAGGAGGAGGAGGAGGACTGCAGCCTAGCAGGACCAAACTCTTACCC
AGGATCTACTGGAGCAGCTGTTGGAGCCCATGACGCCTGTCGGGATGCAAAAGAGAAGCG
CTCTAAAAGCCAAGATGCAGATTCACCTGGAAGTTCTGGGGCCCCTGAAAACTTGACATT
CAAGGAACGCCAGCGTCTTTTTTCACAAGGTCAAGATGTATCCAATAAAGTGAAAGCTTC
TCGTAAATTAACAGAACTGGAGAATGAACTGAACACAAAGTGAAAGAAAATGAGGAGAAC
ACTTTGTATTTACCCCAAAATCTTTTCAGTTGTGGGTTTGTAGGTGCGAGTTTGAAGAGG
AAAAGAGGAAGGGGGTTATATTTCTAAGTGATTTACAATTTCTGTTTCTAAAATTGTTGG
GATTTAGAAATGTTTCAATTCCAAGAAATTTTATTTTACTTTACCATGAGATTGCCATTT
ATGTAATTTAAACACTGTCTAGTTTCTTAATTATCTAACTCACACGAGGGTAAGTTTTTT
GTTGGTTTCTTTTTTGGAGTCCTGAGTTCAAAGGGGACAGAACTAAGGGCAGGAGAAGAG
AATGGATGTGTCTTCTCTCCCATCTTCCCCTCATCATCGACCGAGGAGCACAAAGAAGTT
CTGTTTCTGTTTTTTTCAGAAACTTTATTTTAGCTGTCAAGCAGAGAATAGCTTGAACTA
TTCAGACTATTGTTGGCACTGTTTAGTAGTGACCACACGCTCTTCTACCCGGGAAGGAAC
ATATGACGACATGCTCCTCCCATGTCCCCTGATGGTGTCTGTTCCCACAATATCCTTCTA
GTCTGCATCGTGAAGTGGCTTAGGCCAAAGCTTCCTGTGTGATGACGCACGTCCGAGACT
GTTCCATCTCATTCCTCGCAAATTTGAGCTCTTCTGATCAATTCTAAATATTTGATTAAT
TTTAATTCTGAAAGAAAATTTTGAGGATTTAAGCTTAGGGGATTTTATTTTTATAAATAC
CAGATTATTGTTAGACTTAATAAATCACTGTTAAATTTAAAGATGACAGTTACCTTGGAA
AGTTCACTAATACTTCGCTCCAAGGCGTCTGTAAAAGAAGATATCTTTATTGGAGCAATG
TTCATGTGACTGGGAATGACAGAAGAATGGGAGATGAGTAGGGACCCCTCAAGCACAGCT
GTCACTCAGAAATTTTAAATTTGAAAAAGAAATCGATTTTCATCTGTATGCCGTCAAGGA
AGGAATTCAGTTACAGGGCATCTGTAACTTAAATATTGTAAGAATAACTCATATGGAAGT
TCAAGCTATTTTTATACTATAATAGAGTTATTTAATTTTAATTTGTTGAATTATTAGTTA
CCACTGTCATTTCTTCAGCTATGGATATGTGGCTGATGTTGGGGAGACGGACCTCAGTGT
GTTTTATATTGTCTGGTGTTAAGATGATAAATTACTTTGTGATTACAAGCAAATTTTCTA
TTTGACAAAGCCCTTGGTGGAGTCCAAATGATTTTTCTGTACCATATTGTTCTCTTACAC
ATACGTATGTTAGGAAAATAGGCACACTTTCAAAGAGAATGTTCTCTTACACATACGTAT
GTTAGGAAAATAGACACATTTTCAAAGAGAATGTTCTCTTACATATGTTAGGAAAATAGG
CACACTTTCAAAGAGAGGTATAGGGGCTTTTTACTGCCTTCGAAATCACTTTTAATAAAA
GTTGTATGATAAATCATTAAAAATGCGAGTGTAAATATTTTTTTTTACCTCTATCAGGGT
TTTTATTTGAAAGTGTGCTCTTACCATTTCCTTGTTTGAGTAAGAGAGTGAATGGTTCTG
AGTGTTTAGGAAGGATTTGCTTGCTTGCAGCAGAAGTTCTAGGAAAAGCAGGCACCTCCC
AAATATCTTGAGGACACTGGCAGCCTTATGGTGACTAAATCCACACTTTCTTTAAAGAGA
TGCAGATGAATTACTTTTCTGTTAATATATAGAAAAATACACAGGAGAACATGCAGATAC
ATGTAAATATCTACATACAGGGATATTTGTATGTGTGGTTGTGAAACCCATACACAAGTG
GATTTGGCCATCTTTGGGCAGTGAGGTCAAATGTGAATATGTGTAAAAGTGCTTTTCAGA
ACTGCATTACTATGAGAAAACATCAAAACTGCTGTAGTTTTCCATTTCTACTGTATTTCA
GTTGCAACCTATTTTTAATAAACTTTGTATGTATTTAAGTGTATTTGCTATTGTTTTGAA
AGTGCTGACAAAGTTTATATTTGTAACATCAGCCTTCCTCGCCCATCTCTTTCCATCTGT
CTCTTCTTCATTAAACACTTACTGAGTATGA

Protein Sequence

>4301 : length: 1824
MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKD
DREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQA
SDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSS
DGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARV
MLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHLE
GKTPKGKERADGSGYGSTLPPEKLPYLVELSPGRRNHFAYYNYHTYEDGSDSRDKPKLYR
LQLSVTEVGTEKLDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVEGQRISET
TMLQSGMKVQFGASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDI
HSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQDASGPELI
LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERT
HKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLA
HLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLLRRCRVNA
ALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAAD
CHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIE
NVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPLC
QRGFCRLIPHTRSPGTWTIYFEGADYESHLLRENTELAQPLRKEPEIITVTLKKQNGMGL
SIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTR
TSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYNNSTQNGS
PESPQLPWAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSAYASGTTAKITSV
STGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQWPNYEEKPHMHT
DSNHSSIAIQRVTRSQEELREDKAYQLERHRIEAAMDRKSDSDMWINQSSSLDSSTSSQE
HLNHSSKSVTPASTLTKSGPGRWKTPAAIPATPVAVSQPIRTDLPPPPPPPPVHYAGDFD
GMSMDLPLPPPPSANQIGLPSAQVAAAERRKREEHQRWYEKEKARLEEERERKRREQERK
LGQMRTQSLNPAPFSPLTAQQMKPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITV
SKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKL
MLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQLEEMR
KREAEDRARQEEERRRQEEERTKRDAEEKRRQEEGYYSRLEAERRRQHDEAARRLLEPEA
PGLCRPPLPRDYEPPSPSPAPGAPPPPPQRNASYLKTQVLSPDSLFTAKFVAYNEEEEEE
DCSLAGPNSYPGSTGAAVGAHDACRDAKEKRSKSQDADSPGSSGAPENLTFKERQRLFSQ
GQDVSNKVKASRKLTELENELNTK