ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4299

Name

AFF1

Synonym

AF4|MLLT2|PBM1;AF4/FMR2 family, member 1;AFF1;AF4/FMR2 family, member 1

Definition

AF4/FMR2 family member 1|ALL1-fused gene from chromosome 4 protein|myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2|pre-B-cell monocytic leukemia partner 1|protein AF-4|proto-oncogene AF4

Position

4q21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4299

Links to epithelial mesenchymal transition gene database

4299

Links to ovarian cancer gene database

4299

Links to endometrial cancer gene database

4299

Links to iHOP

4299

Sequence Information

Nucleotide Sequence

>4299 : length: 9758
TTGGGAAATGGGAACAATATATCTGTTTTATAAGATTGTTGTGAAGATGAAACAGGCCTG
TGTGTGAAAGGCCTTTTCTAAATTGTAAAGCGCTCCCCAGATGTTAGTTATTATCTCCTT
TAAAGGGCACAGAATCTGTTTCAATATTATAGGAGGTTGCAAAAAGGCTCCTTGACACTT
TTTGCTCAGAACTTGACCCTGAGCTTAATCTCGCCGTAAAGTGAAAGGGTTCTTGCGCCC
CCACAGCAGCCCGGGGCAGGGTCACCCTCGCGACCGGGGCGGTCATTGCCGTATTCCGTC
CTGAGCTGCCGCTCCCCCACGATCCTCCCACCAATCCCGGGAGGGCCGCGACGTCCCTTG
CCGCTTGGGTGGCGCCAGCTAGAGGGCGCGGGCCGGGGCGGAACCCGGTACCGCAGCTCG
GGAGGTGGGGGTGGGGGCGGGGCCTCGCGCGGAGGGCGTGGCCTCGGGGCGTCCCGGGCA
GCCGGCGTGCTGAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCA
CTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCTTTGCCTCCGCGGTTCCGCA
GCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGC
AACAGGTCAGGGGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAG
GGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGGAAACAATGGCATTTACAGA
AAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAG
AGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGAT
TCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACA
GAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCA
TCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAA
AGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACAC
TCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCC
AAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCA
CCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGA
CCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCT
TTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCA
GCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAA
AGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGAC
CCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTC
CCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGA
TGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCG
ACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACT
GAAGATGCCTTCTCAGTCAGTTGAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGAT
TCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTAC
AGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAAC
CCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAAC
GTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACA
AACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGA
ACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAG
TTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGA
AACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCT
GACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACG
GCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATC
CAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCA
CCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAAC
CGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGAC
CAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTC
CAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACC
CAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCC
CTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGA
GCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAG
CAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACT
CCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACA
AAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAA
GGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTC
TGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGA
AAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTC
ATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTC
CTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAA
GCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAG
TGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGA
GGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCC
TTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTT
TGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGA
GTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCAT
TGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTA
CTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCAC
AGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAA
CATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAA
ACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCAC
AGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTC
AAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCAT
CCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCT
TTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCAC
AAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACA
GGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCA
ATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTC
ATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTT
AAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATG
AGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTA
GCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGA
TACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCA
TCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTT
GGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAG
TAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTT
CTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGC
AACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCA
GCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCC
ACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTA
CCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGT
TGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCA
GATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCT
GTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAA
CAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATA
TTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAG
AGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTT
CACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTA
AGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTA
ACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTA
AAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTA
TCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACT
TTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACA
TTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCC
CTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGG
GATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGT
TTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAG
GTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATT
CCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTA
CTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGT
AGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTC
GATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCC
CCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTT
TATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAG
TGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGC
TTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGA
TTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTC
ATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTT
TTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTT
GCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACT
GCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAG
ATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCA
GAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGG
CACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAG
AACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATT
TAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGT
TCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAA
GCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTT
GATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTA
TCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCC
CTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACC
CCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAG
GAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCAT
TGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAAAGGGATATAAATATATACA
CTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAAT
ACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACT
CCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGG
CTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACT
TAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTT
TAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCT
TGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAA
GTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTT
TTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATG
GATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACG
GCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATG
TGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTC
TTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAAT
ACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACAT
TATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCC
TATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATA
TTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAG
CTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAG
TAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACAT
GTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGG
GTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTT
TTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATT
TATTACCATTATATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTG
GAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTT
GATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAAC
GTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTC
AATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAA
TGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAA
GAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATC
TTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTT
AAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGT
AAAAAAACAAAAAAATTAATAAAAATTTCGAGAAATCA

Protein Sequence

>4299 : length: 1218
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDEL
SSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHH
QSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGS
SNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPPSQTFPPPSLPSKSVAMQQKPTAY
VRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHS
NSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESES
TSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPR
STEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQE
PPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRA
AASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPP
HSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRI
PQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEI
KSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCG
QDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPG
KPQVKFDKQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSK
SAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKY
SRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATI
STPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNSSLVDL
VHYTRQGFQQLQELTKTP