ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4298

Name

MLLT1

Synonym

ENL|LTG19|YEATS1;myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 1;MLLT1;myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 1

Definition

CTC-503J8.6|ENL/MLL fusion|MLLT1/MLL fusion|YEATS domain-containing protein 1|myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocated to, 1|protein ENL

Position

19p13.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4298

Links to epithelial mesenchymal transition gene database

4298

Links to ovarian cancer gene database

4298

Links to endometrial cancer gene database

4298

Links to iHOP

4298

Sequence Information

Nucleotide Sequence

>4298 : length: 4530
GGTTCCGCGGGGCTGGCGGGCGAGCGGGCGGCCGGGATCGGCGGCGGCGGCGGCGGCGGC
GGCGCTTGACAGACAATGAGGGCGGCGGGGCGGCGTTGAGCGGCGGCGGCGGCGGCGGCG
GCGGCGAGCGACGCGGGGCCCGGGGGCGGGGCGGGGCGCCAGCCATGGACAATCAGTGCA
CCGTCCAGGTGAGGTTAGAGCTGGGGCATCGCGCCCAACTGCGCAAGAAGCCCACCACGG
AGGGGTTCACTCACGACTGGATGGTGTTTGTCCGCGGCCCCGAGCAATGTGACATCCAGC
ACTTCGTGGAGAAGGTGGTCTTCTGGCTGCACGACAGCTTCCCCAAGCCCAGACGCGTGT
GCAAGGAGCCCCCCTACAAAGTAGAGGAGTCGGGGTACGCTGGCTTCATCATGCCCATCG
AGGTGCACTTCAAAAACAAGGAGGAGCCGAGGAAGGTCTGCTTCACCTACGACCTGTTCC
TGAACCTGGAAGGCAACCCGCCCGTGAACCACCTGCGCTGCGAGAAGCTCACCTTCAACA
ACCCCACCACGGAGTTCCGGTACAAGCTCCTGCGGGCCGGCGGGGTGATGGTAATGCCCG
AAGGAGCAGACACGGTGTCCAGGCCCAGTCCCGACTACCCCATGTTACCCACAATTCCAC
TCTCTGCCTTCTCTGACCCCAAGAAGACCAAACCATCCCACGGCTCCAAGGACGCCAACA
AGGAGAGCAGCAAGACCTCCAAGCCACACAAGGTGACCAAGGAGCACCGGGAGCGGCCCC
GCAAAGACTCCGAGAGCAAGAGCTCCTCCAAGGAGCTGGAGCGTGAGCAGGCCAAAAGCT
CCAAGGACACCTCGCGGAAGCTGGGCGAGGGCCGGCTGCCCAAGGAGGAGAAGGCGCCAC
CGCCCAAGGCTGCCTTCAAGGAACCCAAGATGGCCCTGAAAGAGACCAAGCTGGAAAGCA
CGTCCCCCAAGGGTGGGCCCCCACCCCCACCCCCACCCCCACCCCGGGCTTCCAGCAAGC
GGCCGGCCACCGCCGACTCGCCAAAGCCCAGCGCCAAGAAGCAGAAGAAGAGCAGCTCGA
AGGGGTCCCGGAGTGCTCCAGGCACCTCGCCCCGCACCTCCTCCTCCTCCTCCTTCTCGG
ACAAGAAGCCGGCCAAGGACAAGAGCAGCACCAGAGGGGAGAAGGTGAAGGCCGAGAGTG
AGCCCCGGGAGGCCAAAAAGGCCCTGGAGGTGGAGGAGTCCAACTCAGAGGACGAGGCCT
CCTTCAAGTCCGAGTCTGCCCAGTCAAGCCCGTCCAACTCCAGCTCCAGCTCAGACTCCA
GCTCAGACTCAGACTTCGAGCCATCCCAGAACCACAGCCAAGGACCCCTGCGCTCCATGG
TGGAGGACCTGCAGTCCGAGGAGTCCGACGAGGACGACTCTTCGTCAGGCGAGGAGGCTG
CCGGCAAGACCAACCCGGGGAGGGACTCCAGGTTGAGCTTCAGCGACAGCGAGAGTGACA
ACAGCGCCGACTCCTCCCTGCCCAGCCGTGAGCCCCCACCCCCCCAGAAGCCACCCCCGC
CCAACAGCAAGGTGTCAGGCCGGAGGAGCCCCGAGTCCTGCAGCAAGCCTGAGAAGATCC
TCAAGAAGGGCACCTACGACAAGGCCTACACGGATGAGCTGGTGGAGCTACACCGGAGGC
TGATGGCGCTGCGGGAGCGCAACGTGCTGCAGCAGATTGTGAATCTGATCGAGGAGACTG
GCCACTTCAATGTCACCAACACCACCTTCGACTTCGACCTCTTCTCCCTGGACGAGACCA
CCGTGCGCAAACTGCAGAGCTGCCTGGAGGCCGTGGCCACATGACCCTGGGCCGCGTGCC
GGGCCCCCACCGCCGGGGTCCTGGGAGGCTGCAGCCAGGCCTCGCCTGCCCTCCTCTCCC
GTCTCGCCTGCCCGCAGCACTGCCTTAGCGACAGCCCTGTCCTCGCCCGCACAGCCCGCT
GCACTTTCCTCGGCGGCTCCCTGCCCACTCTCCCCGCTCCATCGCCAGGAGCCCTGGGGC
CGGGCTGGGCCACACGGGAGCCGCCCCCCGGGCTCTCTGGGCTCCCCTCAGAGAGCGGCT
GGTGTTGAAGGCAGCTCTGGGCAGAGACAGGGCCGGGGGCCCCTCGCCCAGCCTTGGGAC
CAGCCCCCACTGCTCGGCGGGCTGTGCGGCGTCGCTGCCCCAGCCTTTCTGAGCAGCGGA
TCGACGGCTGGGGGGCATCTCCAGCCTCCCGAATGGTTCAGAACACACCCTCCGCCCACC
CTGGACCTCAGAAGGCCCTGCCTGTGTGTCTGCGTCGTCCTCCGTGTAGACCTAGCGCCG
GCTCCTCCCCGGCTCGCGCTGCGCTGGGGTCTGTGCTGTATAGTTCTCTCTATTATATAT
GTGTGTGCACTGTCTGGTCAAGAGCAGTGTCCATGTGCGTTTCTGTGGCAGCAGTGCACG
TGGGGTGGGTGGGGGGTGCGTACGGTGGGGCTTGTAGGTTAAGATGTCTCTGCGGTGGTG
TGGGGCTGGAGGCCGAGCCAGGCACGGCAGCTGGCCCTCTCCAGGCGCATGGAGGAATTC
TCCCTTTGCCGTTCCAAGGATGCCGCCGCCTCCTACCGGGGCTCCCGGGGGGGTCAGCCA
ACACTACAAAGGGCAGCGAGTCCTCAGGGCGCCCGGGAGCCACCAGTCTGCTCTCGGGCT
CTACTCAGACTAGCGCCAACAGTCTCCGCGGACAGACTCGCATCAGCCGCCCTGGGGCTC
GGCCTCCTCCCATAGGCTCCTCTTCCTCTCTTTCATTCAAGTCTTCAAACTTTGAAAAAA
ATATGAGCTTTTGCCAAATAAGACGGGATAGTTTATGGAGTTTTCTGAGGCGCATTGAAC
TCTGGTCAGCCCCTCGAGCGTGGGCTCGGCCATCAGCAGGCCCGGTGGGTTGGCCGGGCT
GGCCCTCCCAGGCTGCCTTTCTCTCTGGTCGCGGCCTGGCCCGCCCCGGCCTCCACCGCC
GCAATTCATGCTGGTGCCGCGCCCGCAGCCCCACTCCTGGTATGCCTGAGATTCTCCAGG
GGCCAAGCCGGTCCTCCTTCCCGGCCCACTCTTCCAGGGCCAGGACGCTCCCGCGGAGCC
AGCCCATCGTGGCTGGGGGTCCCAGGGGCTGGAGGCCTGCCTGGTTAGCCTCTGTTTCCC
AGACATTGACTCGAGGCGCCTCCAGTCCTCTCAACCCCCTGACTTTCAAGTCCTTTCAAG
TCCTTGTGCCCTGACCAAGTTATGAGGAAAAGAGGGCTGAGGGCCTGGAGGTGGGCTCGC
ACCCCCTCGAACCCACCTAGATGTCTCCTCCTCCCCAGCCTATGAGTTCAGACTTGGGGG
GCTCCATCTGTCCCTCCCTGAGGTCCCTCATCTTGTCCCTGCTCTGATTCTGTCAGCAGA
TCCTGAACACTCCTTGGTGGGGACCCATGCCTCCAAGGCTGCCCCCAATGCCAGCTGTCC
TGGGGAAACTCCCCAGAACTCTCGGGGAAAGGCCCGAGAACCTTCGGAGGAAGCCTCCGG
GACTCCTCGCCACCTGCTCTGTTTCTCTCCCGGCCCCACTGCCTTCAGGTATCAGGAAGA
GGGCAGGCCCCTGTGCCCCCTCTCCCCTTCCCAGGGCGGCCAACAATACTCCACCATGGG
GCGCTTCCTTTCTTCTCTGGAAACTAAGACATTGGACTGAAGGAACTGGCCTGAGGGGGG
CTGACCGGGGGCCCGTGCTGCTGGGAGCTCTACGCACAAGAGGCCGCCGGGGTCACGGAC
AGGAACCTCAGCCCAGGGTGCTGGCCTTTCTCCTTCGCAGGAGTCCCCCAAAATCCACAC
AGCGACTCGAGCAGCCTTCCACTCAGCCAGAGGAGGGTCGGGCTCCCCCGCCTGCTCTCG
GTGGTGGCGTCTGGCCCTTCCTGCCGTTTCCAAGGCCTCCGGAAGCACCAACCCAGTTCT
CAGTTACCTCCTCTGGCCGGAAGGCCTCACGTTGTCCTCCAGAGCTGCTCTGGGCCCAGG
GCTGGCTCCGTGACCACCTGATGGACGTGCTGGGCAGCATGGGCTCCCAAGGCAGCATCC
CCAGCTGCTCTCCCACCCCACCCCAGCTGCCCGGCGGCTGGGCCCACGAGGGCTCTGGGG
ACACTTCCATAGGAAAGGGGCCTGGCACTTTGTGATTGCCACGTGTTTCCTGTTAAGCCG
CCTGCCCCCAGTGCAAATCTCTGTGTTTTGCTCTCTCCTGAACAAAAATGTAAACCGACG
CCGGAAAGCAAATGGTATCGAATACCTTTCTTGCCCATAAGGGTTTTTACAAAGAACGTG
TCTCACTAGGAACTAGGACACTCATCGGCCCGAGACCAACTCCTGGATAAAAGGAATAAG
GAGAATCGTGTTTGTAACGAGTTACAGGATTGTTTCTTTCCTGGATTTTAAACTTTTGTT
AAATTGTGAAATTATGGAGGAGTTTTATAGAAAAAAAAAGTGAAATAAAGTCAGATGGGA
AAGCAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>4298 : length: 600
MCAFPAFPQFWDSEIPGQRHQLRSSFCVCVCTCAPVCRLDSDFKRCTVQVRLELGHRAQL
RKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYA
GFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAG
GVMVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTK
EHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALK
ETKLESTSPKGGPPPPPPPPPRASSKRPATADSPKPSAKKQKKSSSKGSRSAPGTSPRTS
SSSSFSDKKPAKDKSSTRGEKVKAESEPREAKKALEVEESNSEDEASFKSESAQSSPSNS
SSSSDSSSDSDFEPSQNHSQGPLRSMVEDLQSEESDEDDSSSGEEAAGKTNPGRDSRLSF
SDSESDNSADSSLPSREPPPPQKPPPPNSKVSGRRSPESCSKPEKILKKGTYDKAYTDEL
VELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVAT