ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

429

Name

ASCL1

Synonym

ASH1|HASH1|MASH1|bHLHa46;achaete-scute family bHLH transcription factor 1;ASCL1;achaete-scute family bHLH transcription factor 1

Definition

ASH-1|achaete scute protein|achaete-scute complex homolog 1|achaete-scute complex-like 1|achaete-scute homolog 1|class A basic helix-loop-helix protein 46

Position

12q23.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Disease

Central hypoventilation syndrome, congenital;OMIM

Disease

Cancer;FunDO

Disease

Haddad syndrome;OMIM

Disease

Brain disease;FunDO

External Links

Links to cell senescence gene database

429

Links to epithelial mesenchymal transition gene database

429

Links to ovarian cancer gene database

429

Links to endometrial cancer gene database

429

Links to iHOP

429

Sequence Information

Nucleotide Sequence

>429 : length: 2490
AGCACTCTCTCACTTCTGGCCAGGGAACGTGGAAGGCGCACCGACAGGGATCCGGCCAGG
GAGGGCGAGTGAAAGAAGGAAATCAGAAAGGAAGGGAGTTAACAAAATAATAAAAACAGC
CTGAGCCACGGCTGGAGAGACCGAGACCCGGCGCAAGAGAGCGCAGCCTTAGTAGGAGAG
GAACGCGAGACGCGGCAGAGCGCGTTCAGCACTGACTTTTGCTGCTGCTTCTGCTTTTTT
TTTTCTTAGAAACAAGAAGGCGCCAGCGGCAGCCTCACACGCGAGCGCCACGCGAGGCTC
CCGAAGCCAACCCGCGAAGGGAGGAGGGGAGGGAGGAGGAGGCGGCGTGCAGGGAGGAGA
AAAAGCATTTTCACTTTTTTTGCTCCCACTCTAAGAAGTCTCCCGGGGATTTTGTATATA
TTTTTTAACTTCCGTCAGGGCTCCCGCTTCATATTTCCTTTTCTTTCCCTCTCTGTTCCT
GCACCCAAGTTCTCTCTGTGTCCCCCTCGCGGGCCCCGCACCTCGCGTCCCGGATCGCTC
TGATTCCGCGACTCCTTGGCCGCCGCTGCGCATGGAAAGCTCTGCCAAGATGGAGAGCGG
CGGCGCCGGCCAGCAGCCCCAGCCGCAGCCCCAGCAGCCCTTCCTGCCGCCCGCAGCCTG
TTTCTTTGCCACGGCCGCAGCCGCGGCGGCCGCAGCCGCCGCAGCGGCAGCGCAGAGCGC
GCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCGCCGCAGCTGAGACCGGCGGC
CGACGGCCAGCCCTCAGGGGGCGGTCACAAGTCAGCGCCCAAGCAAGTCAAGCGACAGCG
CTCGTCTTCGCCCGAACTGATGCGCTGCAAACGCCGGCTCAACTTCAGCGGCTTTGGCTA
CAGCCTGCCGCAGCAGCAGCCGGCCGCCGTGGCGCGCCGCAACGAGCGCGAGCGCAACCG
CGTCAAGTTGGTCAACCTGGGCTTTGCCACCCTTCGGGAGCACGTCCCCAACGGCGCGGC
CAACAAGAAGATGAGTAAGGTGGAGACACTGCGCTCGGCGGTCGAGTACATCCGCGCGCT
GCAGCAGCTGCTGGACGAGCATGACGCGGTGAGCGCCGCCTTCCAGGCAGGCGTCCTGTC
GCCCACCATCTCCCCCAACTACTCCAACGACTTGAACTCCATGGCCGGCTCGCCGGTCTC
ATCCTACTCGTCGGACGAGGGCTCTTACGACCCGCTCAGCCCCGAGGAGCAGGAGCTTCT
CGACTTCACCAACTGGTTCTGAGGGGCTCGGCCTGGTCAGGCCCTGGTGCGAATGGACTT
TGGAAGCAGGGTGATCGCACAACCTGCATCTTTAGTGCTTTCTTGTCAGTGGCGTTGGGA
GGGGGAGAAAAGGAAAAGAAAAAAAAAAGAAGAAGAAGAAGAAAAGAGAAGAAGAAAAAA
ACGAAAACAGTCAACCAACCCCATCGCCAACTAAGCGAGGCATGCCTGAGAGACATGGCT
TTCAGAAAACGGGAAGCGCTCAGAACAGTATCTTTGCACTCCAATCATTCACGGAGATAT
GAAGAGCAACTGGGACCTGAGTCAATGCGCAAAATGCAGCTTGTGTGCAAAAGCAGTGGG
CTCCTGGCAGAAGGGAGCAGCACACGCGTTATAGTAACTCCCATCACCTCTAACACGCAC
AGCTGAAAGTTCTTGCTCGGGTCCCTTCACCTCCTCGCCCTTTCTTAAAGTGCAGTTCTT
AGCCCTCTAGAAACGAGTTGGTGTCTTTCGTCTCAGTAGCCCCCACCCCAATAAGCTGTA
GACATTGGTTTACAGTGAAACTATGCTATTCTCAGCCCTTTGAAACTCTGCTTCTCCTCC
AGGGCCCGATTCCCAAACCCCATGGCTTCCCTCACACTGTCTTTTCTACCATTTTCATTA
TAGAATGCTTCCAATCTTTTGTGAATTTTTTATTATAAAAAATCTATTTGTATCTATCCT
AACCAGTTCGGGGATATATTAAGATATTTTTGTACATAAGAGAGAAAGAGAGAGAAAAAT
TTATAGAAGTTTTGTACAAATGGTTTAAAATGTGTATATCTTGATACTTTAACATGTAAT
GCTATTACCTCTGCATATTTTAGATGTGTAGTTCACCTTACAACTGCAATTTTCCCTATG
TGGTTTTGTAAAGAACTCTCCTCATAGGTGAGATCAAGAGGCCACCAGTTGTACTTCAGC
ACCAATGTGTCTTACTTTATAGAAATGTTGTTAATGTATTAATGATGTTATTAAATACTG
TTCAAGAAGAACAAAGTTTATGCAGCTACTGTCCAAACTCAAAGTGGCAGCCAGTTGGTT
TTGATAGGTTGCCTTTTGGAGATTTCTATTACTGCCTTTTTTTTTCTTACTGTTTTATTA
CAAACTTACAAAAATATGTATAACCCTGTTTTATACAAACTAGTTTCGTAATAAAACTTT
TTCCTTTTTTTAAAATGAAAATAAAAAAAA

Protein Sequence

>429 : length: 236
MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQ
QQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAV
ARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAV
SAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF