ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4286

Name

MITF

Synonym

CMM8|MI|WS2|WS2A|bHLHe32;microphthalmia-associated transcription factor;MITF;microphthalmia-associated transcription factor

Definition

class E basic helix-loop-helix protein 32

Position

3p14.2-p14.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling mediated by p38-alpha and p38-beta;PID Curated;200154

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

melanocyte development and pigmentation pathway;PID BioCarta;100108

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Disease

Drug abuse;FunDO

Disease

Renal Cell cancer;FunDO

Disease

Embryoma;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Genetic disorders;KEGG DISEASE

Disease

Waardenburg syndrome, type IIA;OMIM

Disease

Malignant melanoma;KEGG DISEASE;H00038

Disease

Clear cell carcinoma;FunDO

Disease

Ocular albinism;KEGG DISEASE;H00169

Disease

Melanoma;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Tietz albinism-deafness syndrome;OMIM

Disease

Skin cancers;KEGG DISEASE

Disease

Waardenburg syndrome/ocular albinism, digenic;OMIM

Disease

Inherited disorders of amino acid metabolism;KEGG DISEASE

External Links

Links to cell senescence gene database

4286

Links to epithelial mesenchymal transition gene database

4286

Links to ovarian cancer gene database

4286

Links to endometrial cancer gene database

4286

Links to iHOP

4286

Sequence Information

Nucleotide Sequence

>4286 : length: 4824
AGAGCTCGGCACTGCGCCGGGGCGCACGGCTCGGGGGACCCAGGCCCAGCTACCTTCCCT
CCGCCCCCGGGCTCTGTTCTCACTTTCCAGCAGTGGAAGGACGGGAAGCGGGAGCCATGC
AGTCCGAATCGGGGATCGTGCCGGATTTCGAAGTCGGGGAGGAGTTTCATGAAGAGCCCA
AAACCTATTACGAACTCAAAAGTCAACCGCTGAAGAGCAGGCTATTTTTCTGAGTCAGCC
TATAGGATGGCTTCCCAGGCAGTTCCGCCGAGCATCCTGGGGCCTCCAAGCCTCCGATAA
GCTCCTCCAGTATGACATCACGCATCTTGCTACGCCAGCAACTCATGCGTGAGCAGATGC
AGGAGCAGGAGCGCAGGGAGCAGCAGCAGAAGCTGCAGGCGGCCCAGTTCATGCAACAGA
GAGTGCCCGTGAGTCAGACACCAGCCATAAACGTCAGTGTGCCCACCACCCTTCCCTCTG
CCACGCAGGTGCCGATGGAAGTCCTTAAGGTGCAGACCCACCTCGAAAACCCCACCAAGT
ACCACATACAGCAAGCCCAACGGCAGCAGGTAAAGCAGTACCTTTCTACCACTTTAGCAA
ATAAACATGCCAACCAAGTCCTGAGCTTGCCATGTCCAAACCAGCCTGGCGATCATGTCA
TGCCACCGGTGCCGGGGAGCAGCGCACCCAACAGCCCCATGGCTATGCTTACGCTTAACT
CCAACTGTGAAAAAGAGGGATTTTATAAGTTTGAAGAGCAAAACAGGGCAGAGAGCGAGT
GCCCAGGCATGAACACACATTCACGAGCGTCCTGTATGCAGATGGATGATGTAATCGATG
ACATCATTAGCCTAGAATCAAGTTATAATGAGGAAATCTTGGGCTTGATGGATCCTGCTT
TGCAAATGGCAAATACGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAG
GTCTGCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAA
AAAGGGAGCTCACAGCGTGTATTTTTCCCACAGAGTCTGAAGCAAGAGCACTGGCCAAAG
AGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATG
ACCGCATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGA
ACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGC
AACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGT
TGCTCAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCAT
CCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTG
AGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCG
ATCTCACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACC
AAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACA
CCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCA
AAACAAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAA
TCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATTTAATAACT
TACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTAT
CAATAGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATT
TTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTGTGAACTGA
ATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCC
ATTTTTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCA
AATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAAGAAAGAAA
GAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTAC
TGCCTTAAAGATACAGTACCCCTCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAA
AGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGATCGTCTGGT
TAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATAT
AAAGTCTAATCTTGCTCTCTTTTATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGT
GATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCTCAAAGTAA
AATATTGAGGAGCACTGAAAGTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGAT
AAGAAAACCGAACTGGGCATATTTCTAATTGGCTTTACTATTTTTATTTTTAAATTATGT
TTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAATATATTTG
TATTAATTTGTAAGAATATGCATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCAC
TGGTGGTTTTCCGCATTCTTTGTACACCCATGAAAGAAAACTTTTATGCAAGGTCTTGCA
TTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACTGTTTTTGG
ACACATTTAAGGTGTAGTATTAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTA
CATATTTATTTTTAGGACATGAAAATAGCAATATTCTTGGAGATTGATAACCATAGCATT
AATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTGAATTTATT
TTTAAGAAAGAAATACTGTATTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAG
AAGCAATGTTATAAAGTTAGTTTCAGTGCATTATCTACTTGTGTAGTCCTATGCAATAAC
AGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTGTTATGAGC
CAGGCTGTTGAATGGAATTTCTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAG
CATATCCATTCAGAATGAAGTGCCTTAAATATAGCAGTAGTCTTTTTTGGACTAGCACTG
ACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACGAACATGTA
GCATGGTGCCTATGTAGACAATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATAT
TAAATATATTTTAGTGACAGAGTGCCAACTTCTTTCATCAGGAAACCTTATTCAGGAGGG
TTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGGGTTCAGAG
AGGAGTGATCGTCAGATGTGTGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTT
CCCATGCACGCTGGGCAATGAGAATCCTTGGAAACATTGGTGATGCTATCAGTTTTATAG
CTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCTTAACTGTA
TAGCTCTTTTCCTAGAATAGTGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGT
TCATTGATACAATCATAGCATTGTCTATTTTTCTCTTCATATTTATATGGGGGGGAGGGC
GCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGCTGATTTTG
AGGGTTTTTAAAAATAAAGCAAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGT
TAAGCAACCATATAGAAAGCTTTGTTGAAAGAAAGTATGGCATCTTGTACCACTGCCCTG
ACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCTTAAGAGAC
AATTTCTGCAGGTGGCAGGTGAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTT
TATTTATTTCTTTTTTGCCAAATAGAGTGTGGATTCATTTCAGGGGCTAGCTAAGCCAAG
AGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTCCCCCGATT
CCCGGGTGCAGAATTGTAACTCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAA
ATTGTCCATCTGCCTCTGAGTAGGGCAATGGAAATACCAAACCTTCTGACTTTGCCAAAA
AGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGTTTTTAAAC
AATAAAGCAATAAGAACAAATACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTT
ATTAATATTTTTGAAAAATGCACTGGGAAAAAGTTGATGTCAATAACAGTATAAAACAGC
CCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTACTGTAATG
TTAATAATAGTCACCTGCTGTTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGT
ATATTATGGATCGATATTAATGTATCCAATGAAATAATCGACTTGTTCTTGATAGCCTCA
TTAAAGCATTTGGTTTTTCACATA

Protein Sequence

>4286 : length: 526
MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQ
THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNS
PMAMLTLNSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE
ILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTACIFPTE
SEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDY
IRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNR
IIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSK
LEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC