ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4242

Name

MFNG

Synonym

MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase;MFNG;MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Definition

O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase|beta-1,3-N-acetylglucosaminyltransferase manic fringe

Position

22q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

Notch signaling pathway;PANTHER;P00045

External Links

Links to cell senescence gene database

4242

Links to epithelial mesenchymal transition gene database

4242

Links to ovarian cancer gene database

4242

Links to endometrial cancer gene database

4242

Links to iHOP

4242

Sequence Information

Nucleotide Sequence

>4242 : length: 2129
GGCTAAGCGGGGCGGGGCCAGGCGGTCCCGGAGGCTGCGGCAGGCCGGACAGCGGGAGCA
GGTGGAGGACTGGCGGCGGTCGAGATCGTGCTGCCATGGCTCAGCCTCTGGGTCCAGAGC
CTCAGCTCCTACCTCTTCCCTCCTTGCCAGCCCCTGATGCCTGCCAGACTTTTGCCTCTG
CTGGAGCCCCTGCCTGACCAGCTTCCCCTCCCTGTCTGGTTGGGATTTGGGGGCTGAGCT
GTCTGGGGTCCCAGGGCCAACCAATGCAGTGCCGGCTCCCGCGGGGCCTGGCTGGAGCCC
TCCTCACCCTCCTGTGCATGGGGCTCCTGTGTCTGCGGTACCACTTGAACCTGTCCCCGC
AGCGGGTACAAGGGACCCCCGAGCTGAGCCAGCCGAACCCGGGGCCCCCTAAGCTACAGC
TACACGATGTCTTCATTGCAGTGAAGACGACCCGGGCTTTCCACCGCTTGCGCCTGGAGC
TGCTGCTTGACACGTGGGTTTCCAGGACCAGGGAACAGACATTTGTCTTCACCGACAGCC
CAGACAAAGGCCTCCAGGAGAGACTGGGGTCCCACCTTGTGGTCACCAACTGCTCCGCGG
AACACAGCCACCCAGCTCTGTCCTGCAAGATGGCTGCTGAGTTCGACACCTTCTTGGCCA
GTGGGCTTAGGTGGTTCTGCCATGTGGACGATGACAACTATGTGAACCCAAGGGCGCTGC
TGCAGCTTCTGAGAGCCTTCCCGCTGGCCCGCGACGTCTATGTGGGAAGGCCCAGCCTGA
ACCGGCCCATCCATGCCTCAGAGCCACAGCCCCACAACCGCACGAGGCTGGTACAGTTCT
GGTTTGCCACTGGGGGTGCTGGCTTCTGCATCAATCGCAAACTGGCTTTGAAGATGGCTC
CGTGGGCCAGTGGCTCCCGTTTCATGGACACATCTGCTCTCATCCGGCTGCCTGATGACT
GCACCATGGGCTATATCATTGAGTGCAAGCTGGGCGGCCGCCTGCAGCCCAGCCCCCTCT
TTCACTCCCACCTGGAGACCCTGCAGCTGCTGAGGACTGCACAGCTCCCAGAACAGGTCA
CCCTCAGCTACGGTGTCTTTGAGGGGAAACTCAACGTCATTAAGCTACAGGGCCCCTTCT
CCCCGGAGGAGGACCCCTCCAGATTTCGCTCCCTCCATTGTCTGCTCTATCCAGATACAC
CCTGGTGTCCCCAGCTGGGTGCCCGATGAATCCTGAACTGCTGGGCAAAGGTTGGGCAGA
GACTTCTGGGTGTGCCTTGGCTCCCAAGGTGGCACTGTGGGTCCCTGGCAAGTGTCTTGT
GATAGGCAGTCCCTGGCAGGGCCTTCGGGTGGTTGGCAAGCCCAGGATCTGAGTGGCAAT
TGGCACTGAAGGCACCCCAGGCCCCTGGGAGGTGAGTTAGACAGCCCAGGGGACCAGGTG
GACCAGGTGGTGGCCAGAGAGGCTCCAGGGGCTAGACTCCCTCAGGAGGCTGAATTGAAA
AAGGGCAGGGGGCACTTGAGCTGGGCTGGGGCTCAGGGGTCCTAACCCTTTAGGCAGTGA
CATGGCCTCTGGGTGGGGTCTGGCCGTTGGCCCTGGCTAATGTCTCTCAGTCATTCCCCT
GGGGCTCAAGCGCTGGGCCGCCCACTCCTGCCTCCCTCATCTGTGTCCCGAGTTCCTGAA
GGGACATGGGTGGAATGATGGCAGAATCCAGGGTCTGCAGCACCTGCTGTTGTTGCCAAC
CAGTCTCCCAAAGCTCCTTGCTCCCCACCCCTTGCGAACAGGACCAGATTTTGTTTGGAG
CCTCAGCATGCCGGGGCCCAGATGATGGAGCATAACGGGTCCCAGCCAATTGTGATGATC
CTTTTTGCTCATTTCCCAGCCTTTCTTGCTGTTAGGGGCTACCATGGGACCAGCTCTGGC
CAGAGGGAACTAAGCAAATCCAATAGAGATGTTTCTGGGGAAGGTTTTGCAGCCCACTCC
CCATCTTCCTGCTATAAATGTGGGTGTGATGGCTGGATCTGGGGCAGCCACCTTGCTACC
ATGAAGGAAAGGCCAAGACAATCATCCACAGCTATTCCCTCCAGCATCTGGTTCTGTACA
AAAATTAAATGCTTATTTGTTTAAGTCTC

Protein Sequence

>4242 : length: 321
MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAV
KTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALS
CKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASE
PQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIE
CKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSR
FRSLHCLLYPDTPWCPQLGAR