ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4233

Name

MET

Synonym

AUTS9|HGFR|RCCP2|c-Met;MET proto-oncogene, receptor tyrosine kinase;MET;MET proto-oncogene, receptor tyrosine kinase

Definition

HGF receptor|HGF/SF receptor|SF receptor|hepatocyte growth factor receptor|met proto-oncogene tyrosine kinase|proto-oncogene c-Met|scatter factor receptor|tyrosine-protein kinase Met

Position

7q31

Gene Type

protein-coding

Pathways and Diseases

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

Arf6 signaling events;PID Curated;200060

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Syndecan-1-mediated signaling events;PID Curated;200134

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Cholangiocarcinoma;KEGG DISEASE;H00046

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

Cancer;FunDO

Disease

Cerebellar disease;FunDO

Disease

Pervasive development disorder;FunDO

Disease

Amyotrophic lateral sclerosis;FunDO

Disease

Hepatocellular carcinoma, childhood type;OMIM

Disease

Emphysema;FunDO

Disease

Pancreatitis;FunDO

Disease

IMMUNE;GAD

Disease

Systemic scleroderma;FunDO

Disease

METABOLIC;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Renal cell carcinoma, papillary, familial and sporadic;OMIM

Disease

Autistic disorder;FunDO

Disease

diabetes, type 2;GAD

Disease

PSYCH;GAD

Disease

multiple sclerosis (severity);GAD

Disease

Autism, suseptibility to, 9;OMIM

Disease

Fatty liver;FunDO

Disease

Malaria;FunDO

Disease

Renal cell carcinoma;KEGG DISEASE;H00021

Disease

Cancers;KEGG DISEASE

Disease

Multiple sclerosis (severity);NHGRI

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Autism;GAD

External Links

Links to cell senescence gene database

4233

Links to epithelial mesenchymal transition gene database

4233

Links to ovarian cancer gene database

4233

Links to endometrial cancer gene database

4233

Links to iHOP

4233

Sequence Information

Nucleotide Sequence

>4233 : length: 6695
GCCCTCGCCGCCCGCGGCGCCCCGAGCGCTTTGTGAGCAGATGCGGAGCCGAGTGGAGGG
CGCGAGCCAGATGCGGGGCGACAGCTGACTTGCTGAGAGGAGGCGGGGAGGCGCGGAGCG
CGCGTGTGGTCCTTGCGCCGCTGACTTCTCCACTGGTTCCTGGGCACCGAAAGATAAACC
TCTCATAATGAAGGCCCCCGCTGTGCTTGCACCTGGCATCCTCGTGCTCCTGTTTACCTT
GGTGCAGAGGAGCAATGGGGAGTGTAAAGAGGCACTAGCAAAGTCCGAGATGAATGTGAA
TATGAAGTATCAGCTTCCCAACTTCACCGCGGAAACACCCATCCAGAATGTCATTCTACA
TGAGCATCACATTTTCCTTGGTGCCACTAACTACATTTATGTTTTAAATGAGGAAGACCT
TCAGAAGGTTGCTGAGTACAAGACTGGGCCTGTGCTGGAACACCCAGATTGTTTCCCATG
TCAGGACTGCAGCAGCAAAGCCAATTTATCAGGAGGTGTTTGGAAAGATAACATCAACAT
GGCTCTAGTTGTCGACACCTACTATGATGATCAACTCATTAGCTGTGGCAGCGTCAACAG
AGGGACCTGCCAGCGACATGTCTTTCCCCACAATCATACTGCTGACATACAGTCGGAGGT
TCACTGCATATTCTCCCCACAGATAGAAGAGCCCAGCCAGTGTCCTGACTGTGTGGTGAG
CGCCCTGGGAGCCAAAGTCCTTTCATCTGTAAAGGACCGGTTCATCAACTTCTTTGTAGG
CAATACCATAAATTCTTCTTATTTCCCAGATCATCCATTGCATTCGATATCAGTGAGAAG
GCTAAAGGAAACGAAAGATGGTTTTATGTTTTTGACGGACCAGTCCTACATTGATGTTTT
ACCTGAGTTCAGAGATTCTTACCCCATTAAGTATGTCCATGCCTTTGAAAGCAACAATTT
TATTTACTTCTTGACGGTCCAAAGGGAAACTCTAGATGCTCAGACTTTTCACACAAGAAT
AATCAGGTTCTGTTCCATAAACTCTGGATTGCATTCCTACATGGAAATGCCTCTGGAGTG
TATTCTCACAGAAAAGAGAAAAAAGAGATCCACAAAGAAGGAAGTGTTTAATATACTTCA
GGCTGCGTATGTCAGCAAGCCTGGGGCCCAGCTTGCTAGACAAATAGGAGCCAGCCTGAA
TGATGACATTCTTTTCGGGGTGTTCGCACAAAGCAAGCCAGATTCTGCCGAACCAATGGA
TCGATCTGCCATGTGTGCATTCCCTATCAAATATGTCAACGACTTCTTCAACAAGATCGT
CAACAAAAACAATGTGAGATGTCTCCAGCATTTTTACGGACCCAATCATGAGCACTGCTT
TAATAGGACACTTCTGAGAAATTCATCAGGCTGTGAAGCGCGCCGTGATGAATATCGAAC
AGAGTTTACCACAGCTTTGCAGCGCGTTGACTTATTCATGGGTCAATTCAGCGAAGTCCT
CTTAACATCTATATCCACCTTCATTAAAGGAGACCTCACCATAGCTAATCTTGGGACATC
AGAGGGTCGCTTCATGCAGGTTGTGGTTTCTCGATCAGGACCATCAACCCCTCATGTGAA
TTTTCTCCTGGACTCCCATCCAGTGTCTCCAGAAGTGATTGTGGAGCATACATTAAACCA
AAATGGCTACACACTGGTTATCACTGGGAAGAAGATCACGAAGATCCCATTGAATGGCTT
GGGCTGCAGACATTTCCAGTCCTGCAGTCAATGCCTCTCTGCCCCACCCTTTGTTCAGTG
TGGCTGGTGCCACGACAAATGTGTGCGATCGGAGGAATGCCTGAGCGGGACATGGACTCA
ACAGATCTGTCTGCCTGCAATCTACAAGGTTTTCCCAAATAGTGCACCCCTTGAAGGAGG
GACAAGGCTGACCATATGTGGCTGGGACTTTGGATTTCGGAGGAATAATAAATTTGATTT
AAAGAAAACTAGAGTTCTCCTTGGAAATGAGAGCTGCACCTTGACTTTAAGTGAGAGCAC
GATGAATACATTGAAATGCACAGTTGGTCCTGCCATGAATAAGCATTTCAATATGTCCAT
AATTATTTCAAATGGCCACGGGACAACACAATACAGTACATTCTCCTATGTGGATCCTGT
AATAACAAGTATTTCGCCGAAATACGGTCCTATGGCTGGTGGCACTTTACTTACTTTAAC
TGGAAATTACCTAAACAGTGGGAATTCTAGACACATTTCAATTGGTGGAAAAACATGTAC
TTTAAAAAGTGTGTCAAACAGTATTCTTGAATGTTATACCCCAGCCCAAACCATTTCAAC
TGAGTTTGCTGTTAAATTGAAAATTGACTTAGCCAACCGAGAGACAAGCATCTTCAGTTA
CCGTGAAGATCCCATTGTCTATGAAATTCATCCAACCAAATCTTTTATTAGTACTTGGTG
GAAAGAACCTCTCAACATTGTCAGTTTTCTATTTTGCTTTGCCAGTGGTGGGAGCACAAT
AACAGGTGTTGGGAAAAACCTGAATTCAGTTAGTGTCCCGAGAATGGTCATAAATGTGCA
TGAAGCAGGAAGGAACTTTACAGTGGCATGTCAACATCGCTCTAATTCAGAGATAATCTG
TTGTACCACTCCTTCCCTGCAACAGCTGAATCTGCAACTCCCCCTGAAAACCAAAGCCTT
TTTCATGTTAGATGGGATCCTTTCCAAATACTTTGATCTCATTTATGTACATAATCCTGT
GTTTAAGCCTTTTGAAAAGCCAGTGATGATCTCAATGGGCAATGAAAATGTACTGGAAAT
TAAGGGAAATGATATTGACCCTGAAGCAGTTAAAGGTGAAGTGTTAAAAGTTGGAAATAA
GAGCTGTGAGAATATACACTTACATTCTGAAGCCGTTTTATGCACGGTCCCCAATGACCT
GCTGAAATTGAACAGCGAGCTAAATATAGAGTGGAAGCAAGCAATTTCTTCAACCGTCCT
TGGAAAAGTAATAGTTCAACCAGATCAGAATTTCACAGGATTGATTGCTGGTGTTGTCTC
AATATCAACAGCACTGTTATTACTACTTGGGTTTTTCCTGTGGCTGAAAAAGAGAAAGCA
AATTAAAGATCTGGGCAGTGAATTAGTTCGCTACGATGCAAGAGTACACACTCCTCATTT
GGATAGGCTTGTAAGTGCCCGAAGTGTAAGCCCAACTACAGAAATGGTTTCAAATGAATC
TGTAGACTACCGAGCTACTTTTCCAGAAGATCAGTTTCCTAATTCATCTCAGAACGGTTC
ATGCCGACAAGTGCAGTATCCTCTGACAGACATGTCCCCCATCCTAACTAGTGGGGACTC
TGATATATCCAGTCCATTACTGCAAAATACTGTCCACATTGACCTCAGTGCTCTAAATCC
AGAGCTGGTCCAGGCAGTGCAGCATGTAGTGATTGGGCCCAGTAGCCTGATTGTGCATTT
CAATGAAGTCATAGGAAGAGGGCATTTTGGTTGTGTATATCATGGGACTTTGTTGGACAA
TGATGGCAAGAAAATTCACTGTGCTGTGAAATCCTTGAACAGAATCACTGACATAGGAGA
AGTTTCCCAATTTCTGACCGAGGGAATCATCATGAAAGATTTTAGTCATCCCAATGTCCT
CTCGCTCCTGGGAATCTGCCTGCGAAGTGAAGGGTCTCCGCTGGTGGTCCTACCATACAT
GAAACATGGAGATCTTCGAAATTTCATTCGAAATGAGACTCATAATCCAACTGTAAAAGA
TCTTATTGGCTTTGGTCTTCAAGTAGCCAAAGGCATGAAATATCTTGCAAGCAAAAAGTT
TGTCCACAGAGACTTGGCTGCAAGAAACTGTATGCTGGATGAAAAATTCACAGTCAAGGT
TGCTGATTTTGGTCTTGCCAGAGACATGTATGATAAAGAATACTATAGTGTACACAACAA
AACAGGTGCAAAGCTGCCAGTGAAGTGGATGGCTTTGGAAAGTCTGCAAACTCAAAAGTT
TACCACCAAGTCAGATGTGTGGTCCTTTGGCGTGCTCCTCTGGGAGCTGATGACAAGAGG
AGCCCCACCTTATCCTGACGTAAACACCTTTGATATAACTGTTTACTTGTTGCAAGGGAG
AAGACTCCTACAACCCGAATACTGCCCAGACCCCTTATATGAAGTAATGCTAAAATGCTG
GCACCCTAAAGCCGAAATGCGCCCATCCTTTTCTGAACTGGTGTCCCGGATATCAGCGAT
CTTCTCTACTTTCATTGGGGAGCACTATGTCCATGTGAACGCTACTTATGTGAACGTAAA
ATGTGTCGCTCCGTATCCTTCTCTGTTGTCATCAGAAGATAACGCTGATGATGAGGTGGA
CACACGACCAGCCTCCTTCTGGGAGACATCATAGTGCTAGTACTATGTCAAAGCAACAGT
CCACACTTTGTCCAATGGTTTTTTCACTGCCTGACCTTTAAAAGGCCATCGATATTCTTT
GCTCTTGCCAAAATTGCACTATTATAGGACTTGTATTGTTATTTAAATTACTGGATTCTA
AGGAATTTCTTATCTGACAGAGCATCAGAACCAGAGGCTTGGTCCCACAGGCCACGGACC
AATGGCCTGCAGCCGTGACAACACTCCTGTCATATTGGAGTCCAAAACTTGAATTCTGGG
TTGAATTTTTTAAAAATCAGGTACCACTTGATTTCATATGGGAAATTGAAGCAGGAAATA
TTGAGGGCTTCTTGATCACAGAAAACTCAGAAGAGATAGTAATGCTCAGGACAGGAGCGG
CAGCCCCAGAACAGGCCACTCATTTAGAATTCTAGTGTTTCAAAACACTTTTGTGTGTTG
TATGGTCAATAACATTTTTCATTACTGATGGTGTCATTCACCCATTAGGTAAACATTCCC
TTTTAAATGTTTGTTTGTTTTTTGAGACAGGATCTCACTCTGTTGCCAGGGCTGTAGTGC
AGTGGTGTGATCATAGCTCACTGCAACCTCCACCTCCCAGGCTCAAGCCTCCCGAATAGC
TGGGACTACAGGCGCACACCACCATCCCCGGCTAATTTTTGTATTTTTTGTAGAGACGGG
GTTTTGCCATGTTGCCAAGGCTGGTTTCAAACTCCTGGACTCAAGAAATCCACCCACCTC
AGCCTCCCAAAGTGCTAGGATTACAGGCATGAGCCACTGCGCCCAGCCCTTATAAATTTT
TGTATAGACATTCCTTTGGTTGGAAGAATATTTATAGGCAATACAGTCAAAGTTTCAAAA
TAGCATCACACAAAACATGTTTATAAATGAACAGGATGTAATGTACATAGATGACATTAA
GAAAATTTGTATGAAATAATTTAGTCATCATGAAATATTTAGTTGTCATATAAAAACCCA
CTGTTTGAGAATGATGCTACTCTGATCTAATGAATGTGAACATGTAGATGTTTTGTGTGT
ATTTTTTTAAATGAAAACTCAAAATAAGACAAGTAATTTGTTGATAAATATTTTTAAAGA
TAACTCAGCATGTTTGTAAAGCAGGATACATTTTACTAAAAGGTTCATTGGTTCCAATCA
CAGCTCATAGGTAGAGCAAAGAAAGGGTGGATGGATTGAAAAGATTAGCCTCTGTCTCGG
TGGCAGGTTCCCACCTCGCAAGCAATTGGAAACAAAACTTTTGGGGAGTTTTATTTTGCA
TTAGGGTGTGTTTTATGTTAAGCAAAACATACTTTAGAAACAAATGAAAAAGGCAATTGA
AAATCCCAGCTATTTCACCTAGATGGAATAGCCACCCTGAGCAGAACTTTGTGATGCTTC
ATTCTGTGGAATTTTGTGCTTGCTACTGTATAGTGCATGTGGTGTAGGTTACTCTAACTG
GTTTTGTCGACGTAAACATTTAAAGTGTTATATTTTTTATAAAAATGTTTATTTTTAATG
ATATGAGAAAAATTTTGTTAGGCCACAAAAACACTGCACTGTGAACATTTTAGAAAAGGT
ATGTCAGACTGGGATTAATGACAGCATGATTTTCAATGACTGTAAATTGCGATAAGGAAA
TGTACTGATTGCCAATACACCCCACCCTCATTACATCATCAGGACTTGAAGCCAAGGGTT
AACCCAGCAAGCTACAAAGAGGGTGTGTCACACTGAAACTCAATAGTTGAGTTTGGCTGT
TGTTGCAGGAAAATGATTATAACTAAAAGCTCTCTGATAGTGCAGAGACTTACCAGAAGA
CACAAGGAATTGTACTGAAGAGCTATTACAATCCAAATATTGCCGTTTCATAAATGTAAT
AAGTAATACTAATTCACAGAGTATTGTAAATGGTGGATGACAAAAGAAAATCTGCTCTGT
GGAAAGAAAGAACTGTCTCTACCAGGGTCAAGAGCATGAACGCATCAATAGAAAGAACTC
GGGGAAACATCCCATCAACAGGACTACACACTTGTATATACATTCTTGAGAACACTGCAA
TGTGAAAATCACGTTTGCTATTTATAAACTTGTCCTTAGATTAATGTGTCTGGACAGATT
GTGGGAGTAAGTGATTCTTCTAAGAATTAGATACTTGTCACTGCCTATACCTGCAGCTGA
ACTGAATGGTACTTCGTATGTTAATAGTTGTTCTGATAAATCATGCAATTAAAGTAAAGT
GATGCAACATCTTGTAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>4233 : length: 1409
MKSKSKSLAECFPYDKPLIMKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKY
QLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDC
SSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCI
FSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKE
TKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRF
CSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDI
LFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRT
LLRNSSGCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGR
FMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCR
HFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRL
TICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIIS
NGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKS
VSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTIT
GVGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFF
MLDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKS
CENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSI
STALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESV
DYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPE
LVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEV
SQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDL
IGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKT
GAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRR
LLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKC
VAPYPSLLSSEDNADDEVDTRPASFWETS