ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4218

Name

RAB8A

Synonym

MEL|RAB8;RAB8A, member RAS oncogene family;RAB8A;RAB8A, member RAS oncogene family

Definition

mel transforming oncogene (RAB8 homolog)|mel transforming oncogene (derived from cell line NK14)|mel transforming oncogene (derived from cell line NK14)- RAB8 homolog|oncogene c-mel|ras-associated protein RAB8|ras-related protein Rab-8A

Position

19p13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pancreatic secretion;KEGG PATHWAY;hsa04972

Disease

Cytomegalovirus infection;FunDO

External Links

Links to cell senescence gene database

4218

Links to epithelial mesenchymal transition gene database

4218

Links to ovarian cancer gene database

4218

Links to endometrial cancer gene database

4218

Links to iHOP

4218

Sequence Information

Nucleotide Sequence

>4218 : length: 2194
GTGCCGGCCAATGGGAGGTGCGCTCGGGCTGCTTCCGGCTCCGCGCTCCGCTCGCCCCCT
CCCAAGGTCTCCCCGCGACTGGCGGGACGCAGGGGCGGGCGTCGGCCGCGGTGACGCGCA
GCGGGCCTGGAGCCAATAAGGGGCGGGCTCGGTGCTGATGGACGGTGCTGGTGGCCAGTG
GAGAGGCGCTGGCCGCACTTCCCGTCGGGGAGAGAGTGTAATATGGCGAAGACCTACGAT
TACCTGTTCAAGCTGCTGCTGATCGGGGACTCGGGGGTGGGGAAGACCTGTGTCCTGTTC
CGCTTCTCCGAGGACGCCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTTTAAA
ATTAGGACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGCCGGT
CAGGAACGGTTTCGGACGATCACAACGGCCTACTACAGGGGTGCAATGGGCATCATGCTG
GTCTACGACATCACCAACGAGAAGTCCTTCGACAACATCCGGAACTGGATTCGCAACATT
GAGGAGCACGCCTCTGCAGACGTCGAAAAGATGATACTCGGGAACAAGTGTGATGTGAAT
GACAAGAGACAAGTTTCCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAATCAAG
TTCATGGAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCTCGCC
AGAGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGCAACAGCCCCCAGGGGAGCAAC
CAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGGAGCAGCTTTTTCCGATGTGTTCTT
CTGTGAGGAACACCGCCTTACTCTGAGCCTCGCTCAGCCCAGCTGACTGTGCCTGTTCTG
AGTGAGCCCCTCACTCAGCCGGGGCCCTCCCACCTCCAACGCCCCGCCCACGCCGCGGCC
ACCGGGCCCACGGCCACCAGAATGCAATTGAGAAATCGTTTATTTTAGTAACTGTCTGAT
CTTTTTCAACTTTGGAGATGGAATAAGTTAAAAATTTGCTATTTTTCCTGTAACATCTGC
TGAACGGGCCCACCCACACGTTGTATATTCAGAGAGAGAGAGGGAGTCAAGGTGTGACCG
TCGACCACAGCCAGTGTCAGGCCTCTGCCTCTGGGCCTTTGCTTTGTGGCCTCACTGCAA
CACAAAGCTCCACCAGGAGGCTGGTTCACGTCCCCTACCACGGAAGCGAGGTCCCAGAAG
GCCAGCGGTGGTTCCAGGAGCAACAGCTCCCAAACCCTGAGCAAGGCAACCGATCGCCAG
GACCAGGAAGCATCACCCAGGAGATTTGGCGCCCACTTCCACCTCTTCTCTCAGTTTTGG
ACAAGTGACAAACCATTTTGCCCCCTCACTCTTCTTTTTTAACTGTTAAACCAAAGGAAA
GCACAAATGAAGGAAATCCTGTGTAAAGCATTGAGAAGGAAAGAAGCCTGGAGCAGCCTC
TCCTGTCCACAGCCAGGGGTTAGGTCTGCAGGCCCGTCTGCGGTCCCCATCGAGCATCAA
GGGGACGCTGTGTGTGCTGCAAGTGACCCCGAAAACAACCACAGCCGTCACATGGTCCTC
CTGAAGTTGGGGCACCCTCCTCTCAGCACCAAAATGGCCCCCACTCCTTCGTGTCCTCCC
GCTATCTCCAAATCGGACGTTCTTTCTAGCTGAGATTTTTATTTTTCCACATCTGTAGTG
CCATGAAGCGATTCTGTCTTTGACTTCCAATGGCAAACCTGGGTGATCGGGAACAAGCAC
GTTGTACCCTTGGCTGGACATGGCCAAGACACAAGGCATTCCACGGCGGCAAGCTGACCG
CACAGCAGTCTGGCTTGATTTTCAGCCGTCATCATTGGGTTCTGTTTTGACAGCTCTGCT
GTCCCATAGGGACTGCGACTGGGACCAGGTCAACCACGCCAGGGGGGTGTCACCAGCCTT
TTCTTTTTTTCTTTCTTTTTTTTTTTTTCCTCCTTAAGCTGCTGTCAATCCAAACCATTG
GCATCATCGTTTCTTTTGAATTAAAACCAACATATCAGCAATAGTCTGCTCTCCCCGGGA
ATCTCTAACATGCTCTGTTTACATCGATAAATGCACTTAAGGAAAACAAACAAATTAAAG
CTCATCTTAAAGTCCAAAAAAAAAAAAAAAAAAA

Protein Sequence

>4218 : length: 215
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLGQK
DNMVCKDREPWLGEKLPRSLGQGQGWCLITAGSSS