ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4211

Name

MEIS1

Synonym

Meis homeobox 1;MEIS1;Meis homeobox 1

Definition

Meis1, myeloid ecotropic viral integration site 1 homolog|WUGSC:H_NH0444B04.1|homeobox protein Meis1|leukemogenic homolog protein

Position

2p14

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4211

Links to epithelial mesenchymal transition gene database

4211

Links to ovarian cancer gene database

4211

Links to endometrial cancer gene database

4211

Links to iHOP

4211

Sequence Information

Nucleotide Sequence

>4211 : length: 3504
ATTCTGGTCGGAATCCACCTCTCCGCCTGTGCAACACACACTTTACACACGCACGGGGAC
TGCAAGCGGGCAGCATCGATCGTGGCTCCTTTAAGACAAACTCAGACAGACATTTTTTTT
AACCCTCCTTCTCTAATCTCCTTCCAGTGCAGCACTTGCAAAGAGGGAGAGAGAGGGAGA
GAAAGAAAGAGAGAGAGAGAAGAGAGAAACTGATTAGGAATTAGGACTGATTCAAGGGAA
GCGAGCGCTAGGGCTTTGTGCATTTGAATATTAACATTTGAGGTGTTCTGACCAGAAGAA
GACAGAGCGGATGATCATTCATTCACCACGTTGACAACCTCGCCTGTGATTGACAGCTGG
AGTGGCAGAAAGCCATGAGATTTGGTAGTTGGGTCTGAGGGGCGCTCTTTTTTTTCCTTT
TCTTTCTTTCTTTCTTTTTTTTTTTTTAAACTGATTTTTGGGGGAGAGAAGATCTGCTTT
TTTTTGCCCCCGCTGCTGTCTTGGAAACGGAGCGCTTTTATGCTCAGTGACTCGGGCGCT
TTGCTTCAGGTCCCGTAGACCGAAGATCTGGGACCAGTAGCTCACGTTGCTGGAGACGTT
AAGGGATTTTTCGTCGTGCTTTTTTTTTTTTTTTTTTTTTTTTCCGGGGGAGTTTGAATA
TTTGTTTCTTTTCACACTGGCCTTAAAGAGGATATATTAGAAGTTGAAGTAGGAAGGGAG
CCAGAGAGGCCGATGGCGCAAAGGAGGAAGATGGAAAGTTGTGCATTTGCTTTTGAATTT
GCTTTAAACCTGTACGACGATCTACCCCATTACGGGGGCATGGATGGAGTAGGCATCCCC
TCCACGATGTATGGGGACCCGCATGCAGCCAGGTCCATGCAGCCGGTCCACCACCTGAAC
CACGGGCCTCCTCTGCACTCGCATCAGTACCCGCACACAGCTCATACCAACGCCATGGCC
CCCAGCATGGGCTCCTCTGTCAATGACGCTTTAAAGAGAGATAAAGATGCCATTTATGGA
CACCCCCTCTTCCCTCTCTTAGCACTGATTTTTGAGAAATGTGAATTAGCTACTTGTACC
CCCCGCGAGCCGGGGGTGGCGGGCGGGGACGTCTGCTCGTCAGAGTCATTCAATGAAGAT
ATAGCCGTGTTCGCCAAACAGATTCGCGCAGAAAAACCTCTATTTTCTTCTAATCCAGAA
CTGGATAACTTGATGATTCAAGCCATACAAGTATTAAGGTTTCATCTATTGGAATTAGAG
AAGGTACACGAATTATGTGACAATTTCTGCCACCGGTATATTAGCTGTTTGAAAGGGAAA
ATGCCTATCGATTTGGTGATAGACGATAGAGAAGGAGGATCAAAATCAGACAGTGAAGAT
ATAACAAGATCAGCAAATCTAACTGACCAGCCCTCTTGGAACAGAGATCATGATGACACG
GCATCTACTCGTTCAGGAGGAACCCCAGGCCCTTCCAGCGGTGGCCACACGTCACACAGT
GGGGACAACAGCAGTGAGCAAGGTGATGGCTTGGACAACAGTGTAGCTTCCCCCAGCACA
GGTGACGATGATGACCCTGATAAGGACAAAAAGCGTCACAAAAAGCGTGGCATCTTTCCC
AAAGTAGCCACAAATATCATGAGGGCGTGGCTGTTCCAGCATCTAACACACCCTTACCCT
TCTGAAGAACAGAAAAAGCAGTTGGCACAAGACACGGGACTCACCATCCTTCAAGTGAAC
AATTGGTTTATTAATGCCCGGAGAAGAATAGTGCAGCCCATGATAGACCAGTCCAACCGA
GCAGTAAGTCAAGGAACACCTTATAATCCTGATGGACAGCCCATGGGAGGTTTCGTAATG
GACGGTCAGCAACATATGGGAATTAGAGCACCAGGACCTATGAGTGGAATGGGCATGAAT
ATGGGCATGGAGGGGCAGTGGCACTACATGTAACCTTCATCTAGTTAACCAATCGCAAAG
CAAGGGGGAAGGCTGCAAAGTATGCCAGGGGAGTATGTAGCCCGGGGTGGTCCAATGGGT
GTGAGTATGGGACAGCCAAGTTATACCCAACCCCAGATGCCCCCCCATCCTGCTCAGCTG
CGTCATGGGCCCCCCATGCATACGTACATTCCTGGACACCCTCACCACCCAACAGTGATG
ATGCATGGAGGACCGCCCCACCCTGGAATGCCAATGTCAGCATCAAGCCCCACAGTTCTT
AATACAGGAGACCCAACAATGAGTGGACAAGTCATGGACATTCATGCTCAGTAGCTTAAG
GGAATATGCATTGTCTGCAATGGTGACTGATTTCAAATCATGTTTTTTCTGCAATGACTG
TGGAGTTCCATTCTTGGCATCTACTCTGGACCAAGGAGCATCCCTAATTCTTCATAGGGA
CCTTTAAAAAGCAGGAAATACCAACTGAAGTCAATTTGGGGGACATGCTAAATAACTATA
TAAGACATTAAGAGAACAAAGAGTGAAATATTGTAAATGCTATTATACTGTTATCCATAT
TACGTTGTTTCTTATAGATTTTTTAAAAAAAATGTGAAATTTTTCCACACTATGTGTGTT
GTTTCCATAGCTCTTCACTTCCTCCAGAAGCCTCCTTACATTAAAAAGCCTTACAGTTAT
CCTGCAAGGGACAGGAAGGTCTGATTTGCAGGATTTTTAGAGCATTAAAATAACTATCAG
GCAGAAGAATCTTTCTTCTCGCCTAGGATTTCAGCCATGCGCGCGCTCTCTCTCTTTCTC
TCTCTTTTCCTCTCTCTCCCTCTTTCTAGCCTGGGGCTTGAATTTGCATGTCTAATTCAT
TTACTCACCATATTTGAATTGGCCTGAACAGATGTAAATCGGGAAGGATGGGAAAAACTG
CAGTCATCAACAATGATTAATCAGCTGTTGCAGGCAGTGTCTTAAGGAGACTGGTAGGAG
GAGGCATGGAAACCAAAAGGCCGTGTGTTTAGAAGCCTAATTGTCACATCAAGCATCATT
GTCCCCATGCAACAACCACCACCTTATACATCACTTCCTGTTTTAAGCAGCTCTAAAACA
TAGACTGAAGATTTATTTTTAATATGTTGACTTTATTTCTGAGCAAAGCATCGGTCATGT
GTGTATTTTTTCATAGTCCCACCTTGGAGCATTTATGTAGACATTGTAAATAAATTTTGT
GCAAAAAGGACTGGAAAAATGAACTGTATTATTGCAATTTTTTTTTGTAAAAGTAGCAGT
TTGGTATGAGTTGGCATGCATACAAGATTTACTAAGTGGGATAAGCTAATTATACTTTTT
GTTGTGGATAAACAAATGCTTGTTGATAGCCTTTTTCTATCAAGAAACCAAGGAGCTAAT
TATTAATAACAATCATTGCACACTGAGTCTTAGCGTTTCTGATGGAAACAGTTTGGATTG
TATAATAACGCCAAGCCCAGTTGTAGTCGTTTGAGTGCAGTAATGAAATCTGAATCTAAA
ATAAAAACAAGATTATTTTTGTCA

Protein Sequence

>4211 : length: 481
MAQRRKMESCAFAFEFALNLYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPP
LHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREP
GVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHE
LCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTR
SGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVAT
NIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQ
GTPYNPDGQPMGGFVMDGQQHMGIRAPGLQSMPGEYVARGGPMGVSMGQPSYTQPQMPPH
PAQLRHGPPMHTYIPGHPHHPTVMMHGGPPHPGMPMSASSPTVLNTGDPTMSGQVMDIHA
Q