ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4210

Name

MEFV

Synonym

FMF|MEF|TRIM20;Mediterranean fever;MEFV;Mediterranean fever

Definition

marenostrin|pyrin

Position

16p13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Disease

Vasculitis;FunDO

Disease

amyloidosis;GAD

Disease

arthritis;GAD

Disease

Ulcerative colitis;FunDO

Disease

Amyloidosis;FunDO

Disease

IMMUNE;GAD

Disease

Systemic infection;FunDO

Disease

Other immune system disease;KEGG DISEASE

Disease

Familial Mediterranean fever, AR;OMIM

Disease

METABOLIC;GAD

Disease

IgD;GAD

Disease

Familial Mediterranean fever;FunDO

Disease

secondary and FMF amyloidosis.;GAD

Disease

Familial Mediterranean Fever;GAD

Disease

Brucellosis;FunDO

Disease

Mediterranean fever;GAD

Disease

Behcet's Disease;GAD

Disease

Behcet syndrome;FunDO

Disease

IGA glomerulonephritis;FunDO

Disease

multiple sclerosis;GAD

Disease

Enteritis;FunDO

Disease

Immune system diseases;KEGG DISEASE

Disease

Behcet's disease thromboembolism, venous;GAD

Disease

Rheumatism;FunDO

Disease

Familial Mediterranean fever, AD;OMIM

Disease

ulcerative colitis;GAD

Disease

Familial Mediterranean fever;KEGG DISEASE;H00288

External Links

Links to cell senescence gene database

4210

Links to epithelial mesenchymal transition gene database

4210

Links to ovarian cancer gene database

4210

Links to endometrial cancer gene database

4210

Links to iHOP

4210

Sequence Information

Nucleotide Sequence

>4210 : length: 3507
GAAGCCAGACAGCTGGCTCGAGCCTCTCCTGCTCAGCACCATGGCTAAGACCCCTAGTGA
CCATCTGCTGTCCACCCTGGAGGAGCTGGTGCCCTATGACTTCGAGAAGTTCAAGTTCAA
GCTGCAGAACACCAGTGTGCAGAAGGAGCACTCCAGGATCCCCCGGAGCCAGATCCAGAG
AGCCAGGCCGGTGAAGATGGCCACTCTGCTGGTCACCTACTATGGGGAAGAGTACGCCGT
GCAGCTCACCCTGCAGGTCCTGCGGGCCATCAACCAGCGCCTGCTGGCCGAGGAGCTCCA
CAGGGCAGCCATTCAGGAATATTCCACACAAGAAAACGGCACAGATGATTCCGCAGCGTC
CAGCTCCCTGGGGGAGAACAAGCCCAGGAGCCTGAAGACTCCAGACCACCCCGAGGGGAA
CGAGGGGAACGGCCCTCGGCCGTACGGGGGCGGAGCTGCCAGCCTGCGGTGCAGCCAGCC
CGAGGCCGGGAGGGGGCTGTCGAGGAAGCCCCTGAGCAAACGCAGAGAGAAGGCCTCGGA
GGGCCTGGACGCGCAGGGCAAGCCTCGGACCCGGAGCCCGGCCCTGCCGGGCGGGAGAAG
CCCCGGCCCCTGCAGGGCGCTAGAGGGGGGCCAGGCCGAGGTCCGGCTGCGCAGAAACGC
CAGCTCCGCGGGGAGGCTGCAGGGGCTGGCGGGGGGCGCCCCGGGGCAGAAGGAGTGCAG
GCCCTTCGAAGTGTACCTGCCCTCGGGAAAGATGCGACCTAGAAGCCTTGAGGTCACCAT
TTCTACAGGGGAGAAGGCGCCCGCAAATCCAGAAATTCTCCTGACTCTAGAGGAAAAGAC
AGCTGCGAATCTGGACTCGGCAACAGAACCCCGGGCAAGGCCCACTCCGGATGGAGGGGC
ATCTGCGGACCTGAAGGAAGGCCCTGGAAATCCAGAACATTCGGTCACCGGAAGGCCACC
AGACACGGCTGCGAGTCCCCGCTGCCACGCCCAGGAAGGAGACCCAGTTGACGGTACCTG
TGTGCGTGATTCCTGCAGCTTCCCCGAGGCAGTTTCTGGGCACCCCCAGGCCTCAGGCAG
CCGCTCACCTGGCTGCCCCCGGTGCCAGGACTCCCATGAAAGGAAGAGCCCGGGAAGCCT
AAGCCCCCAGCCCCTGCCACAGTGTAAGCGCCACCTGAAGCAGGTCCAGCTGCTCTTCTG
TGAGGATCACGATGAGCCCATCTGCCTCATCTGCAGTCTGAGTCAGGAGCACCAAGGCCA
CCGGGTGCGCCCCATTGAGGAGGTCGCCCTGGAACACAAGAAGAAAATTCAGAAGCAGCT
GGAGCATCTGAAGAAGCTGAGAAAATCAGGGGAGGAGCAGCGATCCTATGGGGAGGAGAA
GGCAGTGAGCTTTCTGAAACAAACTGAAGCGCTGAAGCAGCGGGTGCAGAGGAAGCTGGA
GCAGGTGTACTACTTCCTGGAGCAGCAAGAGCATTTCTTTGTGGCCTCACTGGAGGACGT
GGGCCAGATGGTTGGGCAGATCAGGAAGGCATATGACACCCGCGTATCCCAGGACATCGC
CCTGCTCGATGCGCTGATTGGGGAACTGGAGGCCAAGGAGTGCCAGTCAGAATGGGAACT
TCTGCAGGACATTGGAGACATCTTGCACAGGGCTAAGACAGTGCCTGTCCCTGAAAAGTG
GACCACTCCTCAAGAGATAAAACAAAAGATCCAACTCCTCCACCAGAAGTCAGAGTTTGT
GGAGAAGAGCACAAAGTACTTCTCAGAAACCCTGCGTTCAGAAATGGAAATGTTCAATGT
TCCAGAGCTGATTGGCGCTCAGGCACATGCTGTTAATGTGATTCTGGATGCAGAAACCGC
TTACCCCAACCTCATCTTCTCTGATGATCTGAAGAGTGTTAGACTTGGAAACAAGTGGGA
GAGGCTGCCTGATGGCCCGCAAAGATTTGACAGCTGTATCATTGTTCTGGGCTCTCCGAG
TTTCCTCTCTGGCCGCCGTTACTGGGAGGTGGAGGTTGGAGACAAGACAGCATGGATCCT
GGGAGCCTGCAAGACATCCATAAGCAGGAAAGGGAACATGACTCTGTCGCCAGAGAATGG
CTACTGGGTGGTGATAATGATGAAGGAAAATGAGTACCAGGCGTCCAGCGTTCCCCCGAC
CCGCCTGCTAATAAAGGAGCCTCCCAAGCGTGTGGGCATCTTCGTGGACTACAGAGTTGG
AAGCATCTCCTTTTACAATGTGACAGCCAGATCCCACATCTATACATTCGCCAGCTGCTC
TTTCTCTGGGCCCCTTCAACCTATCTTCAGCCCTGGGACACGTGATGGAGGGAAGAACAC
AGCTCCTCTGACTATCTGTCCAGTGGGTGGTCAGGGGCCTGACTGAATGCCCAACACTGC
ATCTCTCTTCCTGCTTCTGGCCTTGTATCTTGCATTCACACTCAATAGTCACGGAATGCC
GACTAGGTGCTAGCTGCTATGGGAAATGCAAAAATAACAAAATAGTTACTGTGCCCACGG
AGCCTACCCGATTATAGCAGAGGTAAGTTAGGAACGAACATGTTAGTCAATCCGGGTGAA
GACATGTACTGATGACACACCATGGATTTCAGAGGAGGAAGTACGGAGTCGTTGCATAAT
CCGCCCCTGGTGGGTGGCACTCTCAGGTGCTCCTGAACAGAAGATTTGGCCCTCATTTTC
CCTCAGAACCCCACGGCAAGGATATATGTCCCCTTGTTCTCTCTGCTTCTGTCTTGAGGA
TATGGGAAGCCTAGAGAAACGCAAGCAGACTGGATTGGGATAGAAGTATTTGTGTACCTG
GATTAATGAACTATGATTTTTTTTTTTTTTTTTTGAGACCAAATCTTGCTCTGTGGCCCA
GGCTGGAGTGCAGTGGCACGATCTCAGCTCACTGCAACCTCCACCTCCCAGGTTCAAGCG
ATTCTCCTGCCTCAGCCTCCTGAGCAGCTGGGATTACAGGTGCGTGCCACCACACCAGGC
TGGTTTTCTTGTATTTTTAGTAGAGACGGGGGTTTCACCATGTTAGCCAGGCTGGTCTCG
AACTCCTGACCTCAGGTGATCCACCCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCA
TGAGCCACTGTGCCCGGCCTATGATTCTTTTTTTTTTTTTTTTTTGAGACAAAGTTTTGC
TCTTGTCACCCAGGCTGGAGTGCAGTGGTGCAATCTTGGCTCGCAACCTCCGCCTCCCAG
GTTCAAGAGATTCTCCTGCCTCAGCCTCCGAAGTAGCTGGGATTACAGGCGCCCGCCACC
ATGCCCGGCTAATTTTTTGCATTTTTAGTAGACATGAGGTTTCATCATGTTGGCCAGGCC
GGTCTCAAACTCCTGACCTCAGGTGATGCACCCACCTCAGCCTCCCAAAGTGCAGGGATT
ACAGGCATGAGCCACCATGCCGGGCCATGATTCTTAAGAGAATTGACTGGGCCTCATGAA
TAAAAAAATTAGAAAATCTAAAAAAAA

Protein Sequence

>4210 : length: 781
MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTY
YGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSLGENKPRSLKT
PDHPEGNEGNGPRPYGGGAASLRCSQPEAGRGLSRKPLSKRREKASEGLDAQGKPRTRSP
ALPGGRSPGPCRALEGGQAEVRLRRNASSAGRLQGLAGGAPGQKECRPFEVYLPSGKMRP
RSLEVTISTGEKAPANPEILLTLEEKTAANLDSATEPRARPTPDGGASADLKEGPGNPEH
SVTGRPPDTAASPRCHAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHE
RKSPGSLSPQPLPQCKRHLKQVQLLFCEDHDEPICLICSLSQEHQGHRVRPIEEVALEHK
KKIQKQLEHLKKLRKSGEEQRSYGEEKAVSFLKQTEALKQRVQRKLEQVYYFLEQQEHFF
VASLEDVGQMVGQIRKAYDTRVSQDIALLDALIGELEAKECQSEWELLQDIGDILHRAKT
VPVPEKWTTPQEIKQKIQLLHQKSEFVEKSTKYFSETLRSEMEMFNVPELIGAQAHAVNV
ILDAETAYPNLIFSDDLKSVRLGNKWERLPDGPQRFDSCIIVLGSPSFLSGRRYWEVEVG
DKTAWILGACKTSISRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKEPPKRVGI
FVDYRVGSISFYNVTARSHIYTFASCSFSGPLQPIFSPGTRDGGKNTAPLTICPVGGQGP
D