ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4208

Name

MEF2C

Synonym

C5DELq14.3|DEL5q14.3;myocyte enhancer factor 2C;MEF2C;myocyte enhancer factor 2C

Definition

MADS box transcription enhancer factor 2, polypeptide C|myocyte-specific enhancer factor 2C

Position

5q14.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

carm1 and regulation of the estrogen receptor;PID BioCarta;100219

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Signaling events mediated by HDAC Class II;PID Curated;200019

Pathway

nfat and hypertrophy of the heart ;PID BioCarta;100098

Pathway

alk in cardiac myocytes;PID BioCarta;100244

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

Trk receptor signaling mediated by the MAPK pathway;PID Curated;200182

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

Signaling mediated by p38-alpha and p38-beta;PID Curated;200154

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Myogenesis;Reactome;REACT:21303

Pathway

signal dependent regulation of myogenesis by corepressor mitr;PID BioCarta;100105

Disease

Height;NHGRI

Disease

Bone mineral density (hip);GAD

Disease

Diabetes mellitus;FunDO

Disease

Mental retardation, stereotypic movements, epilepsy, and/or cerebral malformations;OMIM

Disease

Chromosome 5q14.3 deletion syndrome;OMIM

Disease

Tonometry;NHGRI

Disease

tonometry;GAD

Disease

METABOLIC;GAD

Disease

Liver cancer;FunDO

Disease

HIV infection;FunDO

Disease

Bone mineral density (hip);NHGRI

External Links

Links to cell senescence gene database

4208

Links to epithelial mesenchymal transition gene database

4208

Links to ovarian cancer gene database

4208

Links to endometrial cancer gene database

4208

Links to iHOP

4208

Sequence Information

Nucleotide Sequence

>4208 : length: 6449
GAGCTGTTCTCCTTTTCCCATTCGTCTTCTGTCACTTCCTTCCTGGACGCAGTTTTCTGG
ACGAGTCTGGTTACTTTTAATCCGACCGGCCGCTGAGAGCCACTTTCTCCTCCTCCTCCT
CCTCCTCCTTCTCTTCCTCCTCCTTCTTCCTCCTCCTCCTCCTCTTCCGAGCGGCCTCGG
CGCGCGCGAATGCGCGGCCCCGCGCCCCCCCCCTCGCGCGCGCTCCCCTCGCGCGCGCGC
ACACACGCACACATCGTCTCCAGCTCTCTGCTCGCTCTGCTCGCAGTCACAGACACTTGA
GCACACGCGTACACCCAGACATCTTCGGGCTGCTATTGGATTGACTTTGAAGGTTCTGTG
TGGGTCGCCGTGGCTGCATGTTTGAATCAGGTGGAGAAGCACTTCAACGCTGGACGAAGT
AAAGATTATTGTTGTTATTTTTTTTTTCTCTCTCTCTCTCTCTTAAGAAAGGAAAATATC
CCAAGGACTAATCTGATCGGGTCTTCCTTCATCAGGAACGAATGCAGGAATTTGGGAACT
GAGCTGTGCAAGTGCTGAAGAAGGAGATTTGTTTGGAGGAAACAGGAAAGAGAAAGAAAA
GGAAGGAAAAAATACATAATTTCAGGGACGAGAGAGAGAAGAAAAACGGGGACTATGGGG
AGAAAAAAGATTCAGATTACGAGGATTATGGATGAACGTAACAGACAGGTGACATTTACA
AAGAGGAAATTTGGGTTGATGAAGAAGGCTTATGAGCTGAGCGTGCTGTGTGACTGTGAG
ATTGCGCTGATCATCTTCAACAGCACCAACAAGCTGTTCCAGTATGCCAGCACCGACATG
GACAAAGTGCTTCTCAAGTACACGGAGTACAACGAGCCGCATGAGAGCCGGACAAACTCA
GACATCGTGGAGACGTTGAGAAAGAAGGGCCTTAATGGCTGTGACAGCCCAGACCCCGAT
GCGGACGATTCCGTAGGTCACAGCCCTGAGTCTGAGGACAAGTACAGGAAAATTAACGAA
GATATTGATCTAATGATCAGCAGGCAAAGATTGTGTGCTGTTCCACCTCCCAACTTCGAG
ATGCCAGTCTCCATCCCAGTGTCCAGCCACAACAGTTTGGTGTACAGCAACCCTGTCAGC
TCACTGGGAAACCCCAACCTATTGCCACTGGCTCACCCTTCTCTGCAGAGGAATAGTATG
TCTCCTGGTGTAACACATCGACCTCCAAGTGCAGGTAACACAGGTGGTCTGATGGGTGGA
GACCTCACGTCTGGTGCAGGCACCAGTGCAGGGAACGGGTATGGCAATCCCCGAAACTCA
CCAGGTCTGCTGGTCTCACCTGGTAACTTGAACAAGAATATGCAAGCAAAATCTCCTCCC
CCAATGAATTTAGGAATGAATAACCGTAAACCAGATCTCCGAGTTCTTATTCCACCAGGC
AGCAAGAATACGATGCCATCAGTGTCTGAGGATGTCGACCTGCTTTTGAATCAAAGGATA
AATAACTCCCAGTCGGCTCAGTCATTGGCTACCCCAGTGGTTTCCGTAGCAACTCCTACT
TTACCAGGACAAGGAATGGGAGGATATCCATCAGCCATTTCAACAACATATGGTACCGAG
TACTCTCTGAGTAGTGCAGACCTGTCATCTCTGTCTGGGTTTAACACCGCCAGCGCTCTT
CACCTTGGTTCAGTAACTGGCTGGCAACAGCAACACCTACATAACATGCCACCATCTGCC
CTCAGTCAGTTGGGAGCTTGCACTAGCACTCATTTATCTCAGAGTTCAAATCTCTCCCTG
CCTTCTACTCAAAGCCTCAACATCAAGTCAGAACCTGTTTCTCCTCCTAGAGACCGTACC
ACCACCCCTTCGAGATACCCACAACACACGCGCCACGAGGCGGGGAGATCTCCTGTTGAC
AGCTTGAGCAGCTGTAGCAGTTCGTACGACGGGAGCGACCGAGAGGATCACCGGAACGAA
TTCCACTCCCCCATTGGACTCACCAGACCTTCGCCGGACGAAAGGGAAAGTCCCTCAGTC
AAGCGCATGCGACTTTCTGAAGGATGGGCAACATGATCAGATTATTACTTACTAGTTTTT
TTTTTTTTCTTGCAGTGTGTGTGTGTGCTATACCTTAATGGGGAAGGGGGGTCGATATGC
ATTATATGTGCCGTGTGTGGAAAAAAAAAAAGTCAGGTACTCTGTTTTGTAAAAGTACTT
TTAAATTGCCTCAGTGATACAGTATAAAGATAAACAGAAATGCTGAGATAAGCTTAGCAC
TTGAGTTGTACAACAGAACACTTGTACAAAATAGATTTTAAGGCTAACTTCTTTTCACTG
TTGTGCTCCTTTGCAAAATGTATGTTACAATAGATAGTGTCATGTTGCAGGTTCAACGTT
ATTTACATGTAAATAGACAAAAGGAAACATTTGCCAAAAGCGGCAGATCTTTACTGAAAG
AGAGAGCAGCTGTTATGCAACATATAGAAAAATGTATAGATGCTTGGACAGACCCGGTAA
TGGGTGGCCATTGGTAAATGTTAGGAACACACCAGGTCACCTGACATCCCAAGAATGCTC
ACAAACCTGCAGGCATATCATTGGCGTATGGCACTCATTAAAAAGGATCAGAGACCATTA
AAAGAGGACCATACCTATTAAAAAAAAATGTGGAGTTGGAGGGCTAACATATTTAATTAA
ATAAATAAATAAATCTGGGTCTGCATCTCTTATTAAATAAAAATATAAAAATATGTACAT
TACATTTTGCTTATTTTCATATAAAAGGTAAGACAGAGTTTGCAAAGCATTTGTGGCTTT
TTGTAGTTTACTTAAGCCAAAATGTGTTTTTTTCCCCTTGATAGCTTCGCTAATATTTTA
AACAGTCCTGTAAAAAACCAAAAAGGACTTTTTGTATAGAAAGCACTACCCTAAGCCATG
AAGAACTCCATGCTTTGCTAACCAAGATAACTGTTTTCTCTTTGTAGAAGTTTTGTTTTT
GAAATGTGTATTTCTAATTATATAAAATATTAAGAATCTTTTAAAAAAATCTGTGAAATT
AACATGCTTGTGTATAGCTTTCTAATATATATAATATTATGGTAATAGCAGAAGTTTTGT
TATCTTAATAGCGGGAGGGGGGTATATTTGTGCAGTTGCACATTTGAGTAACTATTTTCT
TTCTGTTTTCTTTTACTCTGCTTACATTTTATAAGTTTAAGGTCAGCTGTCAAAAGGATA
ACCTGTGGGGTTAGAACATATCACATTGCAACACCCTAAATTGTTTTTAATACATTAGCA
ATCTATTGGGTCAACTGACATCCATTGTATATACTAGTTTCTTTCATGCTATTTTTATTT
TGTTTTTTGCATTTTTATCAAATGCAGGGCCCCTTTCTGATCTCACCATTTCACCATGCA
TCTTGGAATTCAGTAAGTGCATATCCTAACTTGCCCATATTCTAAATCATCTGGTTGGTT
TTCAGCCTAGAATTTGATACGCTTTTTAGAAATATGCCCAGAATAGAAAAGCTATGTTGG
GGCACATGTCCTGCAAATATGGCCCTAGAAACAAGTGATATGGAATTTACTTGGTGAATA
AGTTATAAATTCCCACAGAAGAAAAATGTGAAAGACTGGGTGCTAGACAAGAAGGAAGCA
GGTAAAGGGATAGTTGCTTTGTCATCCGTTTTTAATTATTTTAACTGACCCTTGACAATC
TTGTCAGCAATATAGGACTGTTGAACAATCCCGGTGTGTCAGGACCCCCAAATGTCACTT
CTGCATAAAGCATGTATGTCATCTATTTTTTCTTCAATAAAGAGATTTAATAGCCATTTC
AAGAAATCCCATAAAGAACCTCTCTATGTCCCTTTTTTTAATTTAAAAAAAATGACTCTT
GTCTAATATTCGTCTATAAGGGATTAATTTTCAGACCCTTTAATAAGTGAGTGCCATAAG
AAAGTCAATATATATTGTTTAAAAGATATTTCAGTCTAGGAAAGATTTTCCTTCTCTTGG
AATGTGAAGATCTGTCGATTCATCTCCAATCATATGCATTGACATACACAGCAAAGAAGA
TATAGGCAGTAATATCAACACTGCTATATCATGTGTAGGACATTTCTTATCCATTTTTTC
TCTTTTACTTGCATAGTTGCTATGTGTTTCTCATTGTAAAAGGCTGCCGCTGGGTGGCAG
AAGCCAAGAGACCTTATTAACTAGGCTATATTTTTCTTAACTTGATCTGAAATCCACAAT
TAGACCACAATGCACCTTTGGTTGTATCCATAAAGGATGCTAGCCTGCCTTGTACTAATG
TTTTATATATTAAAAAAAAAAAATCTATCAACCATTTCATATATATCCCACTACTCAAGG
TATCCATGGAACATGAAAGAATAACATTTATGCAGAGGAAAAACAAAAACATCCCTGAAA
ATATACACACTCATACACACACACGCACAGGGGAATAAAATAAGAAAATCATTTTCCTCA
CCATAGACTTGATCCCATCCTTACAACCCATCCTTCTAACTTGATGTGTATAAAATATGC
AAACATTTCACAAATGTTCTTTGTCATTTCAAAATACTTTAGTATATCAATATCAGTAGA
TACCAGTGGGTGGGAAAGGGTCATTACATGAAAATATGAAGAAATAGCCATATTAGTTTT
TTAACCTGCAATTTGCCTCAGCAACAAAGAAAAAGTGAATTTTTAATGCTGAAGATAAAG
TAAGCTAAAGTACCAGCAGAAGCCTTGGCTATTTATAGCAGTTCTGACAATAGTTTTATA
AGAACATGAAGAGAACAGAATCACTTGAAAATGGATGCCAGTCATCTCTTGTTCCCACTA
CTGAATTCTTATAAAGTGGTGGCAAGATAGGGAAGGGATAATCTGAGAATTTTTAAAAGA
TGATTTAATGAGAAGAAGCACAATTTTGATTTTGATGAGTCACTTTCTGTAAACAATCTT
GGTCTATCTTTACCCTTATACCTTATCTGTAATTTACCATTTATTGTATTTGCAAAGCTA
GTATGGTTTTTAATCACAGTAAATCCTTTGTATTCCAGACTTTAGGGCAGAGCCCTGAGG
GAGTATTATTTTACATAACCCGTCCTAGAGTAACATTTTAGGCAACATTCTTCATTGCAA
GTAAAAGATCCATAAGTGGCATTTTACACGGCTGCGAGTATTGTTATATCTAATCCTATT
TTAAAAGATTTTTGGTAATATGAAGCTTGAATACTGGTAACAGTGATGCAATATACGCAA
GCTGCACAACCTGTATATTGTATGCATTGCTGCGTGGAGGCTGTTTATTTCAACCTTTTT
AAAAATTGTGTTTTTTAGTAAAATGGCTTATTTTTTCCCAAAGGTGGAATTTAGCATTTT
GTAATGATGAATATAAAAATACCTGTCATCCCCAGATCATTTAAAAGTTAACTAAAGTGA
GAATGAAAAAACAAAATTCCAAGACACTTTTTAAAAGAATGTCTGCCCTCACACACTTTT
ATGGATTTGTTTTTCTTACATACCCATCTTTTAACTTAGAGATAGCATTTTTTGCCCTCT
TTATTTTGTTGTTTGTTTCTCCAGAGAGTAAACGCTTTGTAGTTCTTTCTTTAAAAAACA
TTTTTTTTAAAGAAGAAGAAGCCACTTGAACCCTCAATAAAGGCTGTTGCCTAAGCATGG
CATACTTCATCTGTTCTCATTTGTGCCATCTGCCGTGATGTCGTCACTTTTATGGCGTTA
ATTTCCTGCCACTACAGATCTTTTGAAGATTGCTGGAATACTGGTGTCTGTTAGAATGCT
TCAGACTACAGATGTAATTAAAGGCTTTTCTTAATATGTTTTAACCAAAGATGTGGAGCA
ATCCAAGCCACATATCTTCTACATCAAATTTTTCCATTTTGGTTATTTTCATAATCTGGT
ATTGCATTTTGCCTTCCCTGTTCATACCTCAAATTGATTCATACCTCAGTTTAATTCAGA
GAGGTCAGTTAAGTGACGGATTCTGTTGTGGTTTGAATGCAGTACCAGTGTTCTCTTCGA
GCAAAGTAGACCTGGGTCACTGTAGGCATAGGACTTGGATTGCTTCAGATGGTTTGCTGT
ATCATTTTTCTTCTTTTTCTTTTCCTGGGGACTTGTTTCCATTAAATGAGAGTAATTAAA
ATCGCTTGTAAATGAGGGCATACAAGCATTTGCAACAAATATTCAAATAGAGGCTCACAG
CGGCATAAGCTGGACTTTGTCGCCACTAGATGACAAGATGTTATAACTAAGTTAAACCAC
ATCTGTGTATCTCAAGGGACTTAATTCAGCTGTCTGTAGTGAATAAAAGTGGGAAATTTT
CAAAAGTTTCTCCTGCTGGAAATAAGGTATAATTTGTATTTTGCAGACAATTCAGTAAAG
TTACTGGCTTTCTTAGTGAAAAAAAAAAA

Protein Sequence

>4208 : length: 483
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSALNKKENKGCESPD
PDSSYALTPRTEEKYKKINEEFDNMIKSHKIPAVPPPNFEMPVSIPVSSHNSLVYSNPVS
SLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNS
PGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQS
LATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGW
QQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQ
HTRHEAGRSPVDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEG
WAT