ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4170

Name

MCL1

Synonym

BCL2L3|EAT|MCL1-ES|MCL1L|MCL1S|Mcl-1|TM|bcl2-L-3|mcl1/EAT;myeloid cell leukemia 1;MCL1;myeloid cell leukemia 1

Definition

bcl-2-like protein 3|bcl-2-related protein EAT/mcl1|induced myeloid leukemia cell differentiation protein Mcl-1|myeloid cell leukemia ES|myeloid cell leukemia sequence 1 (BCL2-related)

Position

1q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Direct p53 effectors;PID Curated;200101

Disease

Tuberculosis;FunDO

Disease

Testicular dysfunction;FunDO

Disease

Cancer;FunDO

Disease

Rheumatoid arthritis;FunDO

External Links

Links to cell senescence gene database

4170

Links to epithelial mesenchymal transition gene database

4170

Links to ovarian cancer gene database

4170

Links to endometrial cancer gene database

4170

Links to iHOP

4170

Sequence Information

Nucleotide Sequence

>4170 : length: 4107
GCGCAACCCTCCGGAAGCTGCCGCCCCTTTCCCCTTTTATGGGAATACTTTTTTTAAAAA
AAAAGAGTTCGCTGGCGCCACCCCGTAGGACTGGCCGCCCTAAAACCGTGATAAAGGAGC
TGCTCGCCACTTCTCACTTCCGCTTCCTTCCAGTAAGGAGTCGGGGTCTTCCCCAGTTTT
CTCAGCCAGGCGGCGGCGGCGACTGGCAATGTTTGGCCTCAAAAGAAACGCGGTAATCGG
ACTCAACCTCTACTGTGGGGGGGCCGGCTTGGGGGCCGGCAGCGGCGGCGCCACCCGCCC
GGGAGGGCGACTTTTGGCTACGGAGAAGGAGGCCTCGGCCCGGCGAGAGATAGGGGGAGG
GGAGGCCGGCGCGGTGATTGGCGGAAGCGCCGGCGCAAGCCCCCCGTCCACCCTCACGCC
AGACTCCCGGAGGGTCGCGCGGCCGCCGCCCATTGGCGCCGAGGTCCCCGACGTCACCGC
GACCCCCGCGAGGCTGCTTTTCTTCGCGCCCACCCGCCGCGCGGCGCCGCTTGAGGAGAT
GGAAGCCCCGGCCGCTGACGCCATCATGTCGCCCGAAGAGGAGCTGGACGGGTACGAGCC
GGAGCCTCTCGGGAAGCGGCCGGCTGTCCTGCCGCTGCTGGAGTTGGTCGGGGAATCTGG
TAATAACACCAGTACGGACGGGTCACTACCCTCGACGCCGCCGCCAGCAGAGGAGGAGGA
GGACGAGTTGTACCGGCAGTCGCTGGAGATTATCTCTCGGTACCTTCGGGAGCAGGCCAC
CGGCGCCAAGGACACAAAGCCAATGGGCAGGTCTGGGGCCACCAGCAGGAAGGCGCTGGA
GACCTTACGACGGGTTGGGGATGGCGTGCAGCGCAACCACGAGACGGCCTTCCAAGGCAT
GCTTCGGAAACTGGACATCAAAAACGAAGACGATGTGAAATCGTTGTCTCGAGTGATGAT
CCATGTTTTCAGCGACGGCGTAACAAACTGGGGCAGGATTGTGACTCTCATTTCTTTTGG
TGCCTTTGTGGCTAAACACTTGAAGACCATAAACCAAGAAAGCTGCATCGAACCATTAGC
AGAAAGTATCACAGACGTTCTCGTAAGGACAAAACGGGACTGGCTAGTTAAACAAAGAGG
CTGGGATGGGTTTGTGGAGTTCTTCCATGTAGAGGACCTAGAAGGTGGCATCAGGAATGT
GCTGCTGGCTTTTGCAGGTGTTGCTGGAGTAGGAGCTGGTTTGGCATATCTAATAAGATA
GCCTTACTGTAAGTGCAATAGTTGACTTTTAACCAACCACCACCACCACCAAAACCAGTT
TATGCAGTTGGACTCCAAGCTGTAACTTCCTAGAGTTGCACCCTAGCAACCTAGCCAGAA
AAGCAAGTGGCAAGAGGATTATGGCTAACAAGAATAAATACATGGGAAGAGTGCTCCCCA
TTGATTGAAGAGTCACTGTCTGAAAGAAGCAAAGTTCAGTTTCAGCAACAAACAAACTTT
GTTTGGGAAGCTATGGAGGAGGACTTTTAGATTTAGTGAAGATGGTAGGGTGGAAAGACT
TAATTTCCTTGTTGAGAACAGGAAAGTGGCCAGTAGCCAGGCAAGTCATAGAATTGATTA
CCCGCCGAATTCATTAATTTACTGTAGTGTTAAGAGAAGCACTAAGAATGCCAGTGACCT
GTGTAAAAGTTACAAGTAATAGAACTATGACTGTAAGCCTCAGTACTGTACAAGGGAAGC
TTTTCCTCTCTCTAATTAGCTTTCCCAGTATACTTCTTAGAAAGTCCAAGTGTTCAGGAC
TTTTATACCTGTTATACTTTGGCTTGGTTTCCATGATTCTTACTTTATTAGCCTAGTTTA
TCACCAATAATACTTGACGGAAGGCTCAGTAATTAGTTATGAATATGGATATCCTCAATT
CTTAAGACAGCTTGTAAATGTATTTGTAAAAATTGTATATATTTTTACAGAAAGTCTATT
TCTTTGAAACGAAGGAAGTATCGAATTTACATTAGTTTTTTTCATACCCTTTTGAACTTT
GCAACTTCCGTAATTAGGAACCTGTTTCTTACAGCTTTTCTATGCTAAACTTTGTTCTGT
TCAGTTCTAGAGTGTATACAGAACGAATTGATGTGTAACTGTATGCAGACTGGTTGTAGT
GGAACAAATCTGATAACTATGCAGGTTTAAATTTTCTTATCTGATTTTGGTAAGTATTCC
TTAGATAGGTTTTTCTTTGAAAACCTGGGATTGAGAGGTTGATGAATGGAAATTCTTTCA
CTTCATTATATGCAAGTTTTCAATAATTAGGTCTAAGTGGAGTTTTAAGGTTACTGATGA
CTTACAAATAATGGGCTCTGATTGGGCAATACTCATTTGAGTTCCTTCCATTTGACCTAA
TTTAACTGGTGAAATTTAAAGTGAATTCATGGGCTCATCTTTAAAGCTTTTACTAAAAGA
TTTTCAGCTGAATGGAACTCATTAGCTGTGTGCATATAAAAAGATCACATCAGGTGGATG
GAGAGACATTTGATCCCTTGTTTGCTTAATAAATTATAAAATGATGGCTTGGAAAAGCAG
GCTAGTCTAACCATGGTGCTATTATTAGGCTTGCTTGTTACACACACAGGTCTAAGCCTA
GTATGTCAATAAAGCAAATACTTACTGTTTTGTTTCTATTAATGATTCCCAAACCTTGTT
GCAAGTTTTTGCATTGGCATCTTTGGATTTCAGTCTTGATGTTTGTTCTATCAGACTTAA
CCTTTTATTTCCTGTCCTTCCTTGAAATTGCTGATTGTTCTGCTCCCTCTACAGATATTT
ATATCAATTCCTACAGCTTTCCCCTGCCATCCCTGAACTCTTTCTAGCCCTTTTAGATTT
TGGCACTGTGAAACCCCTGCTGGAAACCTGAGTGACCCTCCCTCCCCACCAAGAGTCCAC
AGACCTTTCATCTTTCACGAACTTGATCCTGTTAGCAGGTGGTAATACCATGGGTGCTGT
GACACTAACAGTCATTGAGAGGTGGGAGGAAGTCCCTTTTCCTTGGACTGGTATCTTTTC
AACTATTGTTTTATCCTGTCTTTGGGGGCAATGTGTCAAAAGTCCCCTCAGGAATTTTCA
GAGGAAAGAACATTTTATGAGGCTTTCTCTAAAGTTTCCTTTGTATAGGAGTATGCTCAC
TTAAATTTACAGAAAGAGGTGAGCTGTGTTAAACCTCAGAGTTTAAAAGCTACTGATAAA
CTGAAGAAAGTGTCTATATTGGAACTAGGGTCATTTGAAAGCTTCAGTCTCGGAACATGA
CCTTTAGTCTGTGGACTCCATTTAAAAATAGGTATGAATAAGATGACTAAGAATGTAATG
GGGAAGAACTGCCCTGCCTGCCCATCTCAGAGCCATAAGGTCATCTTTGCTAGAGCTATT
TTTACCTATGTATTTATCGTTCTTGATCATAAGCCGCTTATTTATATCATGTATCTCTAA
GGACCTAAAAGCACTTTATGTAGTTTTTAATTAATCTTAAGATCTGGTTACGGTAACTAA
AAAAGCCTGTCTGCCAAATCCAGTGGAAACAAGTGCATAGATGTGAATTGGTTTTTAGGG
GCCCCACTTCCCAATTCATTAGGTATGACTGTGGAAATACAGACAAGGATCTTAGTTGAT
ATTTTGGGCTTGGGGCAGTGAGGGCTTAGGACACCCCAAGTGGTTTGGGAAAGGAGGAGG
GGAGTGGTGGGTTTATAGGGGGAGGAGGAGGCAGGTGGTCTAAGTGCTGACTGGCTACGT
AGTTCGGGCAAATCCTCCAAAAGGGAAAGGGAGGATTTGCTTAGAAGGATGGCGCTCCCA
GTGACTACTTTTTGACTTCTGTTTGTCTTACGCTTCTCTCAGGGAAAAACATGCAGTCCT
CTAGTGTTTCATGTACATTCTGTGGGGGGTGAACACCTTGGTTCTGGTTAAACAGCTGTA
CTTTTGATAGCTGTGCCAGGAAGGGTTAGGACCAACTACAAATTAATGTTGGTTGTCAAA
TGTAGTGTGTTTCCCTAACTTTCTGTTTTTCCTGAGAAAAAAAAATAAATCTTTTATTCA
AATACAGGGAAAAAAAAAAAAAAAAAA

Protein Sequence

>4170 : length: 350
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR