ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4168

Name

MCF2

Synonym

ARHGEF21|DBL;MCF.2 cell line derived transforming sequence;MCF2;MCF.2 cell line derived transforming sequence

Definition

Oncogene MCF2 (oncogene DBL)|proto-oncogene DBL|proto-oncogene MCF-2

Position

Xq27

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of CDC42 activity;PID Curated;200059

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

Signalling by NGF;Reactome;REACT:11061

External Links

Links to cell senescence gene database

4168

Links to epithelial mesenchymal transition gene database

4168

Links to ovarian cancer gene database

4168

Links to endometrial cancer gene database

4168

Links to iHOP

4168

Sequence Information

Nucleotide Sequence

>4168 : length: 4031
TCAGATTGGCTTTGAAACTTTTTTTCATGTTAAGAGCAAGAAGGCTTTTGTTCTTGGAGC
AGGCAGAGAGTATTGTACATTCTTTTGGCCGAGGAAACAGAATGAGCTGCGACAGTCTTA
AGGACAAACATTTGTGGTAACCCACATTTTGAGGGCCCACTATATGCCAAGCCCTGGAAG
ACAGTGCTTAATAAGACATTTCTTCTGGCATCAAGGGCCTCAGAATATTTCTGAGTGATA
GACCTGCAAACAATTGCAACACATGATAAGAATCAGCTTGAGAAAGAAACCGATCTGCTC
CTCCGTATAAAGGACATCAGTCATTTCTTAATGCAAGACATCGCCTTCTTGTCTGGTGGC
CGGGGAAAGGACAATGCTTGGATCATTACGTTTCCAGAAAACTGTAATTTTAGATGTATA
CCAGAGGAAGTAATAGCAAAAGTACTTACTTACCTGACATCTATTGCAAGGCAAAATGGA
TCAGACTCCCGGTTTACCATTATTCTGGATCGAAGATTGGATACATGGTCTTCTCTCAAA
ATCTCTCTCCAAAAAATCTCGGCTTCCTTCCCTGGGAACTTGCACTTGGTTTTGGTTTTA
CGTCCTACCAGCTTTCTTCAACGAACGTTCACAGACATTGGATTTTGGTTTAGTCAGGAG
GATTTTATGCTTAAATTACCAGTTGTTATGCTGAGCTCAGTTAGTGATTTGCTGACATAC
ATTGATGACAAGCAATTAACCCCTGAGTTAGGCGGCACCTTGCAGTACTGCCACAGTGAA
TGGATCATCTTCAGAAATGCTATAGAAAATTTTGCCCTCACAGTGAAAGAAATGGCTCAG
ATGTTACAGTCCTTTGGAACTGAACTGGCTGAGACAGAACTACCAGATGATATTCCCTCA
ATAGAAGAAATTCTGGCAATTCGTGCTGAAAGGTATCATCTGTTGAAGAATGATATTACA
GCTGTAACCAAAGAAGGAAAAATTCTGCTAACAAATCTGGAAGTGCCTGACACTGAAGGA
GCTGTCAGTTCAAGACTAGAATGTCATCGGCAAATAAGTGGTGACTGGCAAACTATTAAT
AAGTTGCTGACTCAAGTACATGATATGGAAACAGCTTTTGATGGATTTTGGGAAAAACAT
CAATTAAAAATGGAGCAGTATCTGCAACTATGGAAGTTTGAGCAGGATTTTCAACAGCTT
GTGACTGAAGTTGAATTTCTATTAAACCAACAAGCAGAACTGGCTGATGTAACAGGGACT
ATAGCTCAAGTAAAACAAAAAATAAAAAAATTGGAAAACTTAGATGAAAATTCTCAGGAG
CTATTATCAAAGGCCCAGTTTGTGATATTACATGGACACAAGCTTGCAGCAAATCACCAT
TATGCACTTGATTTAATCTGCCAGAGGTGCAATGAGCTACGTTACCTTTCTGATATTTTG
GTTAATGAGATAAAAGCAAAACGGATACAACTCAGCAGGACCTTCAAAATGCATAAACTC
CTACAGCAGGCTCGTCAATGCTGTGATGAAGGGGAATGTCTTCTAGCTAATCAGGAAATA
GATAAGTTTCAGTCTAAAGAAGATGCTCAGAAAGCTCTCCAAGACATTGAAAATTTTCTT
GAAATGGCTCTACCCTTTATAAATTATGAACCTGAAACACTGCAGTATGAATTTGATGTA
ATATTATCTCCTGAGCTTAAGGTTCAAATGAAGACTATACAACTCAAGCTTGAAAACATT
CGAAGTATATTTGAGAACCAGCAGGCTGGTTTCAGGAACCTGGCAGATAAGCATGTGAGG
CCAATCCAATTTGTGGTACCCACACCTGAAAATTTGGTCACATCTGGGACACCATTTTTT
TCATCTAAACAAGTGGGAGTTGGATACTCTTTCTTTCAAGCATGTAAACTTTTTTCAAAA
GGGAAGAAGACTTGGAGACAAAATCAGAGCAACTTAAAAATTGAAGTGGTGCCTGATTGT
CAGGAGAAGAGAAGTTCTGGTCCATCCTCCAGTTTGGACAATGGCAATAGCTTGGATGTT
TTAAAGAACCACGTACTAAATGAACTGATACAGACTGAGAGAGTTTATGTTCGAGAACTG
TATACTGTTTTGTTGGGTTATAGAGCGGAGATGGATAATCCAGAGATGTTTGATCTTATG
CCACCTCTCCTGAGAAATAAAAAGGACATTCTCTTTGGAAACATGGCAGAAATATATGAA
TTCCATAACGACATTTTCTTGAGCAGCCTGGAAAATTGTGCTCATGCTCCAGAAAGAGTG
GGACCTTGTTTCCTGGAAAGGAAGGATGATTTTCAGATGTATGCAAAATATTGTCAGAAT
AAGCCCAGATCAGAAACAATTTGGAGGAAGTATTCAGAATGCGCATTTTTCCAGGAATGT
CAAAGAAAGTTAAAACACAGACTTAGACTGGATTCCTATTTACTCAAACCAGTGCAACGA
ATCACTAAATATCAGTTATTGTTGAAGGAGCTATTAAAATATAGCAAAGACTGTGAAGGA
TCTGCTCTGTTGAAGAAGGCACTCGATGCAATGCTGGATTTACTGAAGTCAGTTAATGAT
TCTATGCATCAGATTGCAATAAATGGCTATATTGGAAACTTAAATGAACTGGGCAAGATG
ATAATGCAAGGTGGATTCAGCGTTTGGATAGGGCACAAGAAAGGTGCTACAAAAATGAAG
GATTTGGCTAGATTCAAACCAATGCAGCGACACCTTTTCTTGTATGAAAAAGCCATTGTT
TTTTGCAAAAGGCGTGTTGAAAGTGGAGAAGGCTCTGACAGATACCCGTCATACAGTTTT
AAACACTGTTGGAAAATGGATGAAGTTGGAATCACTGAATATGTAAAAGGTGATAACCGC
AAGTTTGAAATCTGGTATGGTGAAAAGGAAGAAGTTTATATTGTCCAGGCTTCTAATGTA
GATGTGAAGATGACGTGGCTAAAAGAAATAAGAAATATTTTGTTGAAGCAGCAGGAACTT
TTGACAGTTAAAAAAAGAAAGCAACAGGATCAATTAACAGAACGGGATAAGTTTCAGATT
TCTCTTCAGCAGAATGATGAAAAGCAACAGGGAGCTTTTATAAGTACTGAGGAAACTGAA
TTGGAACACACCAGCACTGTGGTGGAGGTCTGTGAGGCAATTGCGTCAGTTCAGGCAGAA
GCAAATACAGTTTGGACTGAGGCATCACAATCTGCAGAAATCTCTGAAGAACCTGCGGAA
TGGTCAAGCAACTATTTCTACCCTACTTATGATGAAAATGAAGAAGAAAATAGGCCCCTC
ATGAGACCTGTGTCGGAGATGGCTCTCCTATATTGATGAAGCTACTATGTCAAATGGCAA
GTAGCTCTTTCCTGCCTGCTTCTCAGCTCATTTGGAAAAATACTGCGCAAAAGACATTGA
GCTCAAATGATGCAGATGTTGTTTTCAGGTTAATGGACACGCAAAGAAACCACAGCACAT
ACTTCTTTTCTTTCATTTAATAAAGCTTTTAATTATGGTACGCTGTCTTTTTAAAATCAT
GTATTTAATGTGTCAGATATTGTGCTTGAAAGATTCTCATCTCAGAATACTTTTGGACTT
GAAAATTATTTCTTCTCTACTTTGTAACCAAATGCAATCGGTGTGCCTTGGATTATTTAG
TTTATTAATGAATTAAGTCAAAATTACGGCTGCAAAATGGCTAAGGTCAAGTAAAGCACA
ACATTATGATTTAATATGCTTTTGTTGAAACCACAGCTTTTGTGCCCATTGTTTTAACTT
GTGTGAAACAATACAAAGCCCAGAAATTCTTTTCGGGGCATGAGTAAATTTTGTTCAGGG
CTACTGTCTGTATGTGCCCAGATAAAATTTTCATGAGAGTAGTTTACAAAAGCCGTATTT
AAAAGTTAATATTTTCACACTTTTTTTCTGGATTTCTGCTTATAATTAATGTAACTTAAA
TTAGTTGTGCTCTGCTATTTTCTGTATATTTCATGTTGTAATTCTTTTTTTCAAATAAAA
ATTAATTCTTC

Protein Sequence

>4168 : length: 1044
MAMALQRVRIAEKYGKNYLCLLQAVFVAETDLLLRIKDISHFLMQDIAFLSGGRGKDNAW
IITFPENCNFRCIPEEVIAKVLTYLTSIARQNGSDSRFTIILDRRLDTWSSLKISLQKIS
ASFPGNLHLVLVLRPTSFLQRTFTDIGFWFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLT
PELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAI
RAERYHLLKNDITAVTKEGKILLTNLEVPDTEGAVSSRLECHRQISGDWQTINKLLTQVH
DMETAFDGFWEKHQLKMEQYLQLWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQK
IKKLENLDENSQELLSKAQFVILHGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAK
RIQLSRTFKMHKLLQQARQCCDEGECLLANQEIDKFQSKEDAQKALQDIENFLEMALPFI
NYEPETLQYEFDVILSPELKVQMKTIQLKLENIRSIFENQQAGFRNLADKHVRPIQFVVP
TPENLVTSGTPFFSSKQVGVGYSFFQACKLFSKGKKTWRQNQSNLKIEVVPDCQEKRSSG
PSSSLDNGNSLDVLKNHVLNELIQTERVYVRELYTVLLGYRAEMDNPEMFDLMPPLLRNK
KDILFGNMAEIYEFHNDIFLSSLENCAHAPERVGPCFLERKDDFQMYAKYCQNKPRSETI
WRKYSECAFFQECQRKLKHRLRLDSYLLKPVQRITKYQLLLKELLKYSKDCEGSALLKKA
LDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGGFSVWIGHKKGATKMKDLARFKP
MQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWKMDEVGITEYVKGDNRKFEIWYG
EKEEVYIVQASNVDVKMTWLKEIRNILLKQQELLTVKKRKQQDQLTERDKFQISLQQNDE
KQQGAFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYFY
PTYDENEEENRPLMRPVSEMALLY