ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4163

Name

MCC

Synonym

MCC1;mutated in colorectal cancers;MCC;mutated in colorectal cancers

Definition

colorectal mutant cancer protein

Position

5q21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4163

Links to epithelial mesenchymal transition gene database

4163

Links to ovarian cancer gene database

4163

Links to endometrial cancer gene database

4163

Links to iHOP

4163

Sequence Information

Nucleotide Sequence

>4163 : length: 8679
ATGACTCCGGGCGGTCGGAGAAGGTCTGCCGGGAGTACACCTGCCCTCTGCCTGAAGCGT
CCCCAAGTGTCCCGGGCCCGCGTCGTTGCCGGATGCACAATGCTGACACCCTTCCCGGGG
GCTTCCAGTGTATTCTGCCTCCTCTTGTGTTCCCGTTGCCACCCTTAGCTCCCTGACTCT
TCCAGCCACCTTCCCCTCCTCCCTCTTCCCTGAGGTGCCTCCTCGGGCGATTCCAGAGCG
CCCATCTTCCCAGTCCGGGCAAAACCCGGAGAGGTGGAATCCCTCGCCCGGAGCGCCCCG
GCGGCCACTGGGCATGCTCCGTTGTCAGGCAAGTTCGGGGCTGCAGGCAGCTTGCGCGCC
GCGCGGATTCCAGCTGCGGTCGCGCGTACTCCTCCTCCCAAGTAGGGAGCGGGCGCATGA
TGGCGGCCGCGGCGGCAGCGGCTGCGGGGAGCTCCAGCAGCGGCGGCGGCGGCGGCGGCA
GCGGCAGCAGCAGCAGCAGCAGCGACACGTCCAGCACCGGCGAGGAGGAGAGGATGCGGC
GCCTCTTCCAGACGTGCGACGGCGACGGGGACGGATACATCAGCAGAAATGACTTGCTAA
TGGTCTGTCGCCAGCTGAATATGGAAGAGTCTGTGGCTGAGATCATGAACCAGTTGGGAG
CAGATGAAAATGGGAAGATTTCCTTTCAGGATTTCACAAGATGCCGCATGCAGCTTGTTC
GAGAAATTAGGAAGGAGGAAGTAGATCTTTCTGCAAAGTCAGACAACTCCTGTACAAAGA
AGCTGAGGGATAGAATTGCTTCCTGGCCCACGAGCAGTGACAACAGTTTGGGTGCCTTAT
CAGCAGCCAGGGAGAGCTGGGAATACGACTCTGGTGCCAGGGACCTCCAGAGCCCGGATG
TGCAGAGCCAGTCAGCCCTCCAGAAGCTGCTCGAGTATGGCGGAAGCTCTTTGCATCAGC
AGGCTGCTCTCCACAAACTGCTCACACAGTCCCCGCACATTGGCAACTCTGTAGGAGGAA
GCTATCTAGAGCTGGCCAACACACTCCATTCAGCAGCCCTGGCATCACTAAAGGGAGATA
TAGTGGAACTTAATAAACGTCTCCAGCAAACAGAGAGGGAACGGGACCTTCTGGAAAAGA
AATTGGCCAAGGCACAGTGCGAGCAGTCCCACCTCATGAGAGAGCATGAGGATGTCCAGG
AGCGAACGACACTTCGCTATGAGGAACGCATCACAGAGCTCCACAGCGTCATTGCGGAGC
TCAACAAGAAGATAGACCGTCTGCAAGGCACCACCATCAGGGAGGAAGATGAGTACTCAG
AACTGCGATCAGAACTCAGCCAGAGCCAACACGAGGTCAACGAGGACTCTCGAAGCATGG
ACCAAGACCAGACCTCTGTCTCTATCCCCGAAAACCAGTCTACCATGGTTACTGCTGACA
TGGACAACTGCAGTGACCTGAACTCAGAACTGCAGAGGGTGCTGACAGGGCTGGAGAATG
TTGTCTGCGGCAGGAAGAAGAGCAGCTGCAGCCTCTCCGTGGCCGAGGTGGACAGGCACA
TTGAGCAGCTCACCACAGCCAGCGAGCACTGTGACCTGGCTATTAAGACAGTCGAGGAGA
TTGAGGGGGTGCTTGGCCGGGACCTGTATCCCAACCTGGCTGAAGAGAGGTCTCGGTGGG
AGAAGGAGCTGGCTGGGCTGAGGGAAGAGAATGAGAGCCTGACTGCCATGCTGTGCAGCA
AAGAGGAAGAACTGAACCGGACTAAGGCCACCATGAATGCCATCCGGGAAGAGCGGGACC
GGCTCCGGAGGAGGGTCAGAGAGCTTCAAACTCGACTACAGAGCGTGCAGGCCACAGGTC
CCTCCAGCCCTGGCCGCCTCACTTCCACCAACCGCCCGATTAACCCCAGCACTGGGGAGC
TGAGCACAAGCAGCAGCAGCAATGACATTCCCATCGCCAAGATTGCTGAGAGGGTGAAGC
TATCAAAGACAAGGTCCGAATCGTCATCATCTGATCGGCCAGTCCTGGGCTCAGAAATCA
GTAGCATAGGGGTATCCAGCAGTGTGGCTGAACACCTGGCCCACTCACTTCAGGACTGCT
CCAATATCCAAGAGATTTTCCAAACACTCTACTCACACGGATCTGCCATCTCAGAAAGCA
AGATTAGAGAGTTTGAGGTGGAAACAGAACGGCTGAATAGCCGGATTGAGCACCTCAAAT
CCCAAAATGACCTCCTGACCATAACCTTGGAGGAATGTAAAAGCAATGCCGAGAGGATGA
GCATGCTGGTGGGAAAATACGAATCCAATGCCACAGCGCTGAGGCTGGCCTTGCAGTACA
GCGAGCAGTGCATCGAAGCCTACGAACTCCTCCTGGCGCTGGCAGAGAGTGAGCAGAGCC
TCATCCTGGGGCAGTTCCGAGCGGCGGGCGTGGGGTCCTCCCCTGGAGACCAGTCGGGGG
ATGAAAACATCACTCAGATGCTCAAGCGAGCTCATGACTGCCGGAAGACAGCTGAGAACG
CTGCCAAGGCCCTGCTCATGAAGCTGGACGGCAGCTGTGGGGGAGCCTTTGCCGTGGCCG
GCTGCAGCGTGCAGCCCTGGGAGAGCCTTTCCTCCAACAGCCACACCAGCACAACCAGCT
CCACAGCCAGTAGTTGCGACACCGAGTTCACTAAAGAAGACGAGCAGAGGCTGAAGGATT
ATATCCAGCAGCTCAAGAATGACAGGGCTGCGGTCAAGCTGACCATGCTGGAGCTGGAAA
GCATCCACATCGATCCTCTCAGCTATGACGTCAAGCCTCGGGGAGACAGCCAGAGGCTGG
ATCTGGAAAACGCAGTGCTTATGCAGGAGCTCATGGCCATGAAGGAGGAGATGGCCGAGT
TGAAGGCCCAGCTCTACCTACTGGAGAAAGAGAAGAAGGCCCTGGAGCTGAAGCTGAGCA
CGCGGGAGGCCCAGGAGCAGGCCTACCTGGTGCACATTGAGCACCTGAAGTCCGAGGTGG
AGGAGCAGAAGGAGCAGCGGATGCGATCCCTCAGCTCCACCAGCAGCGGCAGCAAAGACA
AACCTGGCAAGGAGTGTGCTGATGCTGCCTCCCCAGCTCTGTCCCTAGCCGAACTCAGGA
CAACGTGCAGCGAGAATGAGCTGGCTGCGGAGTTCACCAACGCCATTCGTCGAGAAAAGA
AGTTGAAGGCCAGAGTTCAAGAGCTGGTGAGTGCCTTGGAGAGACTCACCAAGAGCAGTG
AAATCCGACATCAGCAATCTGCAGAGTTCGTGAATGATCTAAAGCGGGCCAACAGCAACC
TGGTGGCTGCCTATGAGAAAGCAAAGAAAAAGCATCAAAACAAACTGAAGAAGTTAGAGT
CGCAGATGATGGCCATGGTGGAGAGACATGAGACCCAAGTGAGGATGCTCAAGCAAAGAA
TAGCTCTGCTAGAGGAGGAGAACTCCAGGCCACACACCAATGAAACTTCGCTTTAATCAG
CACTCACGCACCGGAGTTCTGCCCATGGGAAGTAAACTGCAGCAGGCCACTGGGGACAGA
AGGGCCCATGTACTTGTTGGGAGGAGGAGGAAAGGGAAGGCTGGCAGGTAGGTCGGCACT
TGGACAATGGAGTGCCCCAACTCAACCCTTGGGGCGACTGGCCATGGTGACATTGTGGAC
TGTATCCAGAGGTGCCCGCTCTTCCCTCCTGGGCCCACAACAGCGTGTAAACACATGTTC
TGTGCCTGCTCAGCAGAGCCTCGTTTCTGCTTTCAGCACTCACTCTCCCCCTCCTCTTCT
GGTCTGGCGGCTGTGCATCAGTGGGATCCCAGACATTTGTTTCTGTAAGATTTTCCATTG
TATCCTCTTTTTGGTAGATGCTGGGCTCATCTTCTAGAATCTCGTTTCTCCTCTTTCCTC
CTGCTTCATGGGAAAACAGACCTGTGTGTGCCTCCAGCATTTAAAAGGACTGCTGATTTG
TTTACTACAGCAAGGCTTTGGTTTCCAAGTCCCGGGTCTCAACTTTAAGATAGAGGCGGC
CATAAGAGGTGATCTCTGGGAGTTATAGGTCATGGGAAGAGCGTAGACAGGTGTTACTTA
CAGTCCCAGATACACTAAAGTTACAAACAGACCACCACCAGGACTGTGCCTGAACAATTT
TGTATTGAGAGAATAAAAACTTCCTTCAATCTTCATTTTGGAGGCAGGGCTGGGAAGGGA
GCGCTCTCTTGATTCTGGGATTTCTCCCTCTCAGTGGAGCCTTATTAATATCCAAGACTT
AGAGCTGGGAATCTTTTTGATACCTGTAGTGGAACTAAAATTCTGTCAGGGGTTTCTTCA
AGAGCTGAGAAACATTATTAGCACTTCCCGCCCCAGGGCACTACATAATTGCTGTTCTGC
TGAATCAAATCTCTTCCACATGGGTGCATTTGTAGCTCTGGACCTGTCTCTACCTAAGGA
CAAGACACTGAGGAGATACTGAACATTTTGCAAAACTTATCACGCCTACTTAAGAGTGCT
GTGTAACCCCCAGTTCAAGACTTAGCTCCTGTTGTCATGACGGGGACAGAGTGAGGGAAT
GGTAGTTAAGGCTTCTTTTTTGCCCCCAGATACATGGTGATGGTTAGCATATGGTGCTTA
AAAGGTTAAATTTCAAGCAAAATGCTTACAGGGCTAGGCAGTACCAAAGTAACTGAATTA
TTTCAGGAAGGTCTTCAATCTTAAAACAAATTCATTATTCTTTTTCAGTTTTACCTCTTC
TCTCTCAGTTCTACACTGATACACTTGAAGGACCATTTACTGTTTTTTTCTGTAGCACCA
GAGAATCCATCCAAAGTTCCCTATGAAAAATGTGTTCCATTGCCATAGCTGACTACAAAT
TAAAGTTGAGGAGGTTTCTGCATAGAGTCTTTATGTCCATAAGCTACGGGTAGGTCTATT
TTCAGAGCATGATACAAATTCCACAGCCTTCTGTTCGCTGGAGGATACTCCAGCCACCAG
TTCGGAGGGCAGACAGCTGTATCCTAAAAGCAACCACTGAGAGGCCAGCAGTGAGGCTGC
CCATCTCCAAAACGAAACAACAGATCAACTGGTATCAGTCTAGAAGGACCAGCTTTGGGG
TGCTTTGATCACTATGAAAATGTTCACTGGTTTCTGTCAATCATTTGGTCAAAGTTAGTT
CCTGTGATTTTTTTTTTTTTTTTTTGAGATGGAGTTTTGCTCGTCACCAGGCTGAAGTGC
AGTGGCGTGATCTTGGCTCACTGCAACCTCTGCCTCCTGAGTAGCTGGAATTACAGGTGC
CCGCCACCATACCCAGCTAGTTTTTTTGTATTTTTAGTAGAGACAGGGTTTCACCATGTT
GGCCAGGCTGGTCTCGAACTCCTGACCACTGATCCACCCACCTCGGCCTCCCAAAGTGCT
GGGATTACAGGCATGAGCCAATGTGCCTGGCCATTCCTGTGATTTTTTAGAATTTTTCAC
TTTTCATATAAAGTTGCATTTTATCATGAGGAAAATGTTTTGGCTGAAAAACATATGCCC
CAAAAAAAAAAAAATCAGTTTTCACTATTTTTCCAGCTTGCCTAGGGAAACGTCCTCCCC
TGAGCAAAGTGGGATGTGCATGGCTCTTTTTTGTGATTAAGCAGGCATCAAATGGGCAGT
TTTCATTTTCACTGACACAGAAACATGTGGCTGAAGCAGGAATAAAATCCTGCCTACTGA
CTTCTGTCTCCATTCTTGCTCCAGGTAAAATCAGAGAACCTCCCCTTCTCTGAGAATTCC
CCCAGGCAGAGGCGGCTCCAGCTCCTGTTAAGGGCCCCAGTTTTACTCATGCTACCTGAC
CTTAGTTTTAGTACTTTCAAATGTGATTTGGGTAAAAACTATTTTGCAGGCAAAAGTGTT
AATTTTTTATAAATATGTATAATAAAAAAGCTATAAAAGTTTTTCCTTTTCTTGTATTTT
TCAAATACTCCCCAAGACACAATCCTTGAAGGTGAACTAGGTGGCACTTGATTATGCTAA
TTGTGGGAGCTACTGAACTAAACTATACTGATTAAATTAAATGCTTGCAGGTTCCTGGGT
AATTTTCCTTTGTGAATAACCTGGCGCTACCTGAATTTTTCTCTAACAAACATCTCCAAT
GAGGGTAAACAATGATCTTGATTCTAATTTATATGAGGTTAAAAACCTTCAGATTTCGTA
TTTTGAATTGTTCTCCCTAGTTTCCTCAGTGGTTACCCCCTTTTAGTCAGTAACCATCTC
TGTTCAGAATTCAGTCTTTGGCTTTTGAAGAAATGGGCACAGAGCCAAAGGACCCATTTC
ACAGTTCCCTTGGAATATATTTCCCATTGTTGGACTGAGGCAAACAAAACCAACTGTGCA
AATCACAAGCAAAAGAGACTTCTGTCCGTAGTTGCGAGTGCCATCAGTGTGAGCTTACCA
GCTACAAAAATCTGTCATGGACTGGGGAACAGTATGATTCCTTATTGAAACTTTCATCCT
CATCGGCTGGCTTGTCAGCGTTCTGAAGTTAATATCCATGCTGCCTGAAACAAATGTTAT
GTTTAACTAGCACTTAACTTTTAAAATTGCTTAATTCTCCTTTCAGATGCATGCACTAAG
TCTTCTCTGAGCCTGCAGCAATATTTTAGAGGGACCTCTTCTAAGTCAGAGCCTTGACAT
TCTACTCCAAAAGGAAGTCCAAATTAGAGCCCATAGGCTTTTTCTTAAAAGCTGTTAAGG
AGTAGTAAAGAAAGTTACCACTCTAAGGAAAACATGAAACTATCTGAAAGTCTTCTGGTT
CCTAACTGGATACAGATTAGATTATTTTAAATGAGAAAAAAGTGCACCGTAGTTACCCGA
TCAAGATTGGACTGCCTGTGTCCCTGGCATGAATTAAAGAACCTCCATAGTTGCTTGTTC
CCTTCTGAAGGTGTTTCCTATGGCCCACGAGAATTATAAAGCAATCACTTTTTAAGTCTA
TCAGTCAACCTTAATAGCTCTCAAGAGTTTCGATTATCAAGCTTTAAAGTGATAACATAT
CAAGATGACTATTAAAAAATAAACATCTCTGAAAGTGTCCTTTCCTCCATAAGGCTTTAA
ACAATTTGCAAATTCTTAATTGGGAGTATGTCCCAATCATTCTATTAAACTATTTACAGC
TCTACCTACTTCTAGATTCAGCAAACAGAGCTACTAGTTAGAGTATTTTGAGAGCCAAAA
TAGTAAGAGACTTCTGTAATGGTTGAGATTTCTGCACTGACCTTAATTAGGGTACCGCCA
TAGGGCTACCAAAGTTTTTAGTGAGGGCTGGGGAGGTGGAGCATAAGTAACATTTTTTTT
CTGCAGAAGGTGATGGCTTTGTAGAACACTATAAAATTTTTCAGGAAAACATACAGCAAA
TTTTCTTATCCAGTGGGAACAGCCTATTTGACAAGGAATGATATACAAGTTTGATTCACC
TTTGAGCACTCTTATAGAGTTTACAGAAGAGGCGTAACTGGTTACAAAACAAAAGTTACG
CCTTCACTATCCAGTTCTTAAAGTTTATCCACATCCTACAAATCTTATGTTCATGTAGGT
CAGGTTAAAGTAAGCTCCAAACTTGTGGCCTTCAGAAGCATCTCCTGTTTAACACACCTG
AAATTACTCTAACTTAATACATTTGTATTCTCTAAGAAATAATGCTGACTGCTGTCACCA
CAGCATCACTGATCTCTCAGTGGCTGTTAAAATATAAACAAGTGGAAAAAAAGTATACAA
GTTGATAGCAGCTGTTCATGTATTCTTGTTTTGCTAATACCTGTGTAGAGAAAGACAGTT
TCACATGCAGATCACCATACATTTTTGCTTAAAGGTTACACTGGGTAAACTGTTTGTTTA
TCACATTACATCTGGGTGAGATTTTGCATGTGACCAAGAGGAAGAAATCATTCAGTCCCG
GAAATAGCAACTGCTATGTAAAACCACATCCTTGACTAGTACTTCATCTTTCCACAGTCA
TCCATCTGCTAATCAGGTGAAATATCAGCTCAGCAGAACAAAGCAAGTTATACACAAATT
TCCCCCACATTCACACTGATGCCGTACTTAGTAATTCTGGTTCTACCATTCCCTTTTGCA
CTTTTTGCAAGTCAAATTCATGTGGAAAAATGTTCTGTTTGTAGAACTCATAGTATTCAC
TTATAGTGCTCATGTCAGGAATGGCAAGTGAGTAAGAGCCCCTGATAATCTGCTTTTGTT
AGAACGTAATGCAAAGATAATAAAACATGTCCACTTCTTTTCTAGTTCTAATCAGTTTTT
AGACATCAAGATTTATTTACTTTGCATGAGATTTGTTTCCTATTATTTGAATATGTGCTA
TACACTTGAATTAGAAAAACCTGCTTGAATGTATTGTCAGTTATTAAAGCACATGTGACT
AAGTTTGCATTTGTCAGTATTGTTCTACTGTTTGTACTGAAAGTCTCATTTTAAAATTGC
TACTTAACACTGTACTATACCTTGTAATTTTTTAGATTCTCCACTTGTATTCTTTAAATG
TTTCCAGATGCCTTTAGTTTTAGCTGCTGTAAAATAGCTACTTTGCGTTATTTGATATAG
AATTGTTTTTTAAAAACTCCATTTATTTATACAGAGACATTTATAATATTTTACAAACAT
TCTTATATTCTGAATAAATATTTCTAATTCCACAGTGTA

Protein Sequence

>4163 : length: 1019
MMAAAAAAAAGSSSSGGGGGGSGSSSSSSDTSSTGEEERMRRLFQTCDGDGDGYISRNDL
LMVCRQLNMEESVAEIMNQLGADENGKISFQDFTRCRMQLVREIRKEEVDLSAKSDNSCT
KKLRDRIASWPTSSDNSLGALSAARESWEYDSGARDLQSPDVQSQSALQKLLEYGGSSLH
QQAALHKLLTQSPHIGNSVGGSYLELANTLHSAALASLKGDIVELNKRLQQTERERDLLE
KKLAKAQCEQSHLMREHEDVQERTTLRYEERITELHSVIAELNKKIDRLQGTTIREEDEY
SELRSELSQSQHEVNEDSRSMDQDQTSVSIPENQSTMVTADMDNCSDLNSELQRVLTGLE
NVVCGRKKSSCSLSVAEVDRHIEQLTTASEHCDLAIKTVEEIEGVLGRDLYPNLAEERSR
WEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQAT
GPSSPGRLTSTNRPINPSTGELSTSSSSNDIPIAKIAERVKLSKTRSESSSSDRPVLGSE
ISSIGVSSSVAEHLAHSLQDCSNIQEIFQTLYSHGSAISESKIREFEVETERLNSRIEHL
KSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESEQ
SLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLDGSCGGAFAV
AGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLEL
ESIHIDPLSYDVKPRGDSQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKL
STREAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSGSKDKPGKECADAASPALSLAEL
RTTCSENELAAEFTNAIRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANS
NLVAAYEKAKKKHQNKLKKLESQMMAMVERHETQVRMLKQRIALLEEENSRPHTNETSL