ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4152

Name

MBD1

Synonym

CXXC3|PCM1|RFT;methyl-CpG binding domain protein 1;MBD1;methyl-CpG binding domain protein 1

Definition

CXXC-type zinc finger protein 3|methyl-CpG binding domain protein 1 isoform PCM1|methyl-CpG-binding domain protein 1|protein containing methyl-CpG-binding domain 1|the regulator of fibroblast growth factor 2 (FGF-2) transcription

Position

18q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

mechanisms of transcriptional repression by dna methylation;PID BioCarta;100112

Disease

Rett syndrome;FunDO

Disease

CANCER;GAD

Disease

Autistic disorder;FunDO

Disease

Chronic lymphocytic leukemia;GAD

External Links

Links to cell senescence gene database

4152

Links to epithelial mesenchymal transition gene database

4152

Links to ovarian cancer gene database

4152

Links to endometrial cancer gene database

4152

Links to iHOP

4152

Sequence Information

Nucleotide Sequence

>4152 : length: 4657
GAGCAACGAACAGCCGCGGAGGCGACAGCTACCGCTTCAGAGGAGGCGGCCGCGGAGGAG
GAGGAAGGGGAGGAGGGCGAGGCGGGAGGTGCAGGAGGGACCCTCGCCATGGGTCCACGG
GCCTAGAGTGGCGGAAGATACCGGCCTGGTGCCAAACTGGCTACTGCTGCTTCCTGTGGC
CTCCATGGCTGAGGACTGGCTGGACTGCCCGGCCCTGGGCCCTGGCTGGAAGCGCCGCGA
AGTCTTTCGCAAGTCAGGGGCCACCTGTGGACGCTCAGACACCTATTACCAGAGCCCCAC
AGGAGACAGGATCCGAAGCAAAGTTGAGCTGACTCGATACCTGGGCCCTGCGTGTGATCT
CACCCTCTTCGACTTCAAACAAGGCATCTTGTGCTATCCAGCCCCCAAGGCCCATCCCGT
GGCGGTTGCCAGCAAGAAGCGAAAGAAGCCTTCAAGGCCAGCCAAGACTCGGAAACGTCA
GGTTGGACCCCAGAGTGGTGAGGTCAGGAAGGAGGCCCCGAGGGATGAGACCAAGGCTGA
CACTGACACAGCCCCAGCTTCATTCCCTGCTCCTGGGTGCTGTGAGAACTGTGGAATCAG
CTTCTCAGGGGATGGCACCCAAAGGCAGCGGCTCAAAACGTTGTGCAAAGACTGTCGAGC
ACAGAGAATTGCCTTCAACCGGGAACAGAGAATGTTTAAGCGTGTGGGCTGTGGGGAGTG
TGCAGCCTGCCAGGTAACAGAAGACTGTGGGGCCTGCTCCACCTGCCTCCTGCAGCTGCC
CCATGATGTGGCATCGGGGCTGTTCTGCAAGTGTGAACGGAGACGCTGCCTCCGGATTGT
GGAAAGGAGCCGAGGGTGTGGAGTATGCCGGGGCTGTCAGACCCAAGAGGATTGTGGCCA
TTGCCCCATCTGCCTTCGCCCTCCCCGCCCTGGTCTCAGGCGCCAGTGGAAATGTGTCCA
GCGACGTTGCCTACGGGGTAAACATGCCCGCCGCAAGGGAGGCTGTGACTCCAAGATGGC
TGCCAGGCGGCGCCCCGGAGCCCAGCCACTGCCTCCACCACCCCCATCACAGTCCCCAGA
GCCCACAGAGCCGCACCCCAGAGCCCTGGCCCCCTCGCCACCTGCCGAGTTCATCTATTA
CTGTGTAGACGAGGACGAGCTACAGCCCTACACGAACCGCCGGCAGAACCGCAAGTGCGG
GGCCTGTGCAGCCTGCCTACGGCGGATGGACTGTGGCCGCTGCGACTTCTGCTGCGACAA
GCCCAAATTCGGGGGCAGCAACCAGAAGCGCCAGAAGTGTCGTTGGCGCCAATGCCTGCA
GTTTGCCATGAAGCGGCTGCTGCCCAGTGTCTGGTCAGAGTCTGAGGATGGGGCAGGATC
GCCCCCACCTTACCGTCGTCGAAAGAGGCCCAGCTCTGCCCGACGGCACCATCTTGGCCC
TACCTTGAAGCCCACCTTGGCTACACGCACAGCCCAACCAGACCATACCCAGGCTCCAAC
GAAGCAGGAAGCAGGTGGTGGCTTTGTGCTGCCCCCGCCTGGCACTGACCTTGTGTTTTT
ACGGGAAGGCGCAAGCAGTCCTGTGCAGGTGCCGGGCCCTGTTGCAGCTTCCACAGAAGC
CCTGTTGCAGGAGGCCCAGTGCTCTGGCCTGAGTTGGGTTGTGGCCTTACCCCAGGTGAA
GCAAGAGAAGGCGGATACCCAGGACGAGTGGACACCAGGCACAGCTGTCCTGACTTCTCC
CGTATTGGTGCCTGGCTGCCCTAGCAAGGCAGTAGACCCAGGCCTGCCTTCTGTGAAGCA
AGAGCCACCTGACCCAGAGGAGGACAAGGAGGAGAACAAGGATGATTCTGCCTCCAAATT
GGCCCCAGAGGAAGAGGCAGGAGGGGCTGGCACACCCGTGATCACGGAGATTTTCAGCCT
GGGTGGAACCCGCTTCCGAGATACAGCAGTCTGGTTGCCAAGGTCCAAAGACCTTAAAAA
ACCTGGAGCTAGAAAGCAGTAGACTGGAGGCTTCTACAGACTGTAGGATTCAAGGTGATA
TTTGCAGACTGGCTTTATGAGAGACAACACTGATCTACTAGGGGCTGGACCCTAGATTGG
TTGCCAGGGCTTGTGTGTGAATCAACCCTAGGAGGAAAAACCTACTACCAAACCAGAAGA
GCAGGCCTAAGAGTACTTTGAGCTTCTAGAAGAAGTAAGCGGGAAAGGAAGAGAAAGAGT
AGAAAGTTGGTGCATCTTCTCCTCCCCAAGAGCCTGAGTATAAGAAGTTGGATTTTAAGG
GTGGGGGAGCTGGGTTGGAGAAAGGTAATATAATTAAAGCCACCACAAAACAACCTAAAC
AAGCCATGTTCATGAGTAATTGTAAGTGGCTTCTGGATGAGACCTGGCAGTGTCTCTACA
TACTTCCTCAGGGAGATAGCAATTGAAAATGTAATTGAATAAATAAGGAAAGGAACTGCT
ATTTGGTGTGTTCCTCTGTGGACCCAGTTTATTTAATCCTTAAAATAATATTTTTGGGAA
GACATTGATTTTGTCCATTTATGTGGATGGGAAAACTGAGACTCATTAATTTGTCCAATG
TCGAACAGCTGGTGTTAGTAGAGCCTAGACTCAAACCCAGCTTTTAAAGCCCTTGTTCTT
TACTCCACTAAACTGTAACCTGTAATCCTGTATGCACTAACAGGAGTTTTCGGTGACCTT
GAAAACACAGATTACTATAATTACTATAATAAATCCCTTACATTCCTGTCTCTAGCATGG
TTTAGGGAGTGCCAAGGCTCAATGTAGATGGGGTCACCTTGTCAGAGCATCTGTTCATAC
AGAAACTGGGTTTCCTGCAGACCCCAGGTGCTGCATAGGATTCCTCAAACCCTACAGGAT
ATATCTCCCCACTGGCTGCTGTCCATTTTGCTTGTTACCCTGACTCCCCCTCTTCAGCCA
GAGCAGTCTTTGTAACTAAAGCTGCCAGCCTGGCTCATCTTTCCTGACAACGTGCATCTC
CTGCCCTGTGATCACCTTTGTGCTTGGCTCCTGCCCTCAGCCTGAATGTGTTCTAGGAGG
CTGAATTCCTGCTTCGAGTCCTGCCCAAGAGCCAGTCTTGGCTCAGCCCTACCTCACTCT
CTCCCAATTCTTCATTCATAAAGTGCCAAAAAGATTAGACCTGTAATTTGTTAGCCAGCT
TTACAGGGCCAGGACTGAGTGAGTGCCTCCTTAAACTTTGTATCCTGTGTGCCTCCCTTG
CCTTACCCTAGTCCCAGCCCTGCAGCTTTAAGTAATTCAGACATGGATTAGCCATTTCCC
AGTTCTGTCTCATACAGTCCAGCCTCTGCCACCTTCCCCACCCCTTCCTTTATTCCATCC
TAACTAGTTCAGCCCTAGTCAAGACTGGATAGACTGATACTGCTTTGTTTCCCCCAGGAA
CCAACCACCCAACCCCAGTATTCTGGTAATTTTGACAATGATCTATATGAAATTTATTTG
ATTGACATTTAGACTCATGAGTTAAGCTTCTGCTGACCATTTATGTTAGGGTACAATCAG
AGGAGCAGAACCACTAAGATAAAGATTATGTATATATGTATTTTAAGGGATTTATTATAG
GGATCTGACCGCATGCCATTGTGGGAGCTGGTTAAACAGTCTCTGTAAGGCTGTTGTCTT
TGCATCTAATGCTGGAGCTTGAAGTCTGCAGGGCAGGCACTCGGGAAGGGAAGATGGATG
TAAAGTGTGGGAGACCGAGGACACAGTGGAGCCCACGAGCACGAGCTGGAACCCACGAGG
ATGGCCTGGAACCCATGTCAGTCTCTCACCACCTCCAGCTTCGATGATGTGGGTGTCCTG
CAGAAGAAGCTGGTGCCCTTCCTCACAGAGTTAAATATGCATCTGGCCCAGGAATTAGAG
AAGCTGAAAGGATGATCCTGGGGAAGGTGGAGCAGCTGCAGGCCTGGCTGCAGGCCTGAC
TACTGCCCACACCAACGAGGTGATCTAGCAGATACATGGCAACGTGTGAACTGCAACAAC
GCCTGGTGCCCCAGCACCAACCTTCCAAGTGTAAAAACAATGTGCTGCTGCTTCACTTCC
GCCCTCCGGTTATCAAGCAAAATGTCTCTTGTGGCCCATCTTACTGGAAGAGAGTTCCGG
GAAACATAGCCTCACCAAGGTGACACATTACAAAGCCACCCTACCATGAATCCGCTCCCA
AGGGTCTCACTGCTCACCTGAGGATAACTCAATATAACTATGTGGCTGAAAATGCAAAGC
TGAAGACCATGGATTTCATGGTGATTCCAGCAAGTACAGAGATTCTATGAAGCCCACCCA
GAAAAAACTTGCTGGTCCTGGCTATTTTTGTGTCATTTATTCAAGTATTGAGAACCTGGC
CTGTGGTAGGCACTGTACTTAATACTAGGATACAGAAATGCAAAAGATACGGCCCATGCA
ATTTTATTAAATGCATCAATATGTATTACAAATGGTGAATGGATTTCCAACTTTATCATG
GAATTTAATGCTGAATATATAGAATTCAGAAAATTGTTGGGAGGACAGCCCTTTTGTGAA
CCTTGTTTGGGGCACAGTAGGAATTGGAAATAATTTAGTTTCTATCTCTAAGCTGTTCTA
TTTTAAAATTATTTTTAAATTTTTATTGTCCCACTTA

Protein Sequence

>4152 : length: 680
MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLT
LFDFKQGILCYPAPKAHPVAVASKKRKKPSRPAKTRKRQVGPQSGEVRKEAPRDETKADT
DTAPASFPAPGCCENCGISFSGDGTQRQRLKTLCKDCRAQRIAFNREQRMFKRVGCGECA
ACQVTEDCGACSTCLLQLPHDVASGLFCKCERRRCLRIVERSRGCGVCRGCQTQEDCGHC
PICLRPPRPGLRRQWKCVQRRCLRHLAHRLRRRHQRCQRRTPLAVAPPTGKHARRKGGCD
SKMAARRRPGAQPLPPPPPSQSPEPTEPHPRALAPSPPAEFIYYCVDEDELQPYTNRRQN
RKCGACAACLRRMDCGRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKRLLPSVWSESED
GAGSPPPYRRRKRPSSARRHHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTD
LVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAV
LTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITE
IFSLGGTRFRDTAVWLPSLQGRHSGREDGCKVWETEDTVEPTSTSWNPRGWPGTHVSLSP
PPASMMWVSCRRSWCPSSQS