ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

415116

Name

PIM3

Synonym

pim-3;Pim-3 proto-oncogene, serine/threonine kinase;PIM3;Pim-3 proto-oncogene, serine/threonine kinase

Definition

pim-3 oncogene|serine/threonine kinase Pim-3|serine/threonine-protein kinase pim-3

Position

22q13

Gene Type

protein-coding

External Links

Links to cell senescence gene database

415116

Links to epithelial mesenchymal transition gene database

415116

Links to ovarian cancer gene database

415116

Links to endometrial cancer gene database

415116

Links to iHOP

415116

Sequence Information

Nucleotide Sequence

>415116 : length: 2410
GAGAGCGTGAGCGCGGAGAGCGGACCGACGCGACACGCCGTGCGCCTCCGCGGCTGCGCT
ACGAAAACGAGTCCCGGAGCGGCCCCGCGCCCGCCGCACCCGGCCCTCGCCCGCCCGAAG
ACAGGCGCCAAGCTGCCCCGCCGTCTCCCCAGCTAGCGCCCGGCCGCCGCCGCCTCGCGG
GCCCCGGGCGGAAGGGGGCGGGGTCCCGATTCGCCCCGCCCCCGCGGAGGGATACGCGGC
GCCGCGGCCCAAAACCCCCGGGCGAGGCGGCCGGGGCGGGTGAGGCGCTCCGCCTGCTGC
GCGTCTACGCGGTCCCCGCGGGCCTTCCGGGCCCACTGCGCCGCGCGGACCGCCTCGGGC
TCGGACGGCCGGTGTCCCCGGCGCGCCGCTCGCCCGGATCGGCCGCGGCTTCGGCGCCTG
GGGCTCGGGGCTCCGGGGAGGCCGTCGCCCGCGATGCTGCTCTCCAAGTTCGGCTCCCTG
GCGCACCTCTGCGGGCCCGGCGGCGTGGACCACCTCCCGGTGAAGATCCTGCAGCCAGCC
AAGGCGGACAAGGAGAGCTTCGAGAAGGCGTACCAGGTGGGCGCCGTGCTGGGTAGCGGC
GGCTTCGGCACGGTCTACGCGGGTAGCCGCATCGCCGACGGGCTCCCGGTGGCTGTGAAG
CACGTGGTGAAGGAGCGGGTGACCGAGTGGGGCAGCCTGGGCGGCGCGACCGTGCCCCTG
GAGGTGGTGCTGCTGCGCAAGGTGGGCGCGGCGGGCGGCGCGCGCGGCGTCATCCGCCTG
CTGGACTGGTTCGAGCGGCCCGACGGCTTCCTGCTGGTGCTGGAGCGGCCCGAGCCGGCG
CAGGACCTCTTCGACTTTATCACGGAGCGCGGCGCCCTGGACGAGCCGCTGGCGCGCCGC
TTCTTCGCGCAGGTGCTGGCCGCCGTGCGCCACTGCCACAGCTGCGGGGTCGTGCACCGC
GACATTAAGGACGAAAATCTGCTTGTGGACCTGCGCTCCGGAGAGCTCAAGCTCATCGAC
TTCGGTTCGGGTGCGCTGCTCAAGGACACGGTCTACACCGACTTCGACGGCACCCGAGTG
TACAGCCCCCCGGAGTGGATCCGCTACCACCGCTACCACGGGCGCTCGGCCACCGTGTGG
TCGCTGGGCGTGCTTCTCTACGATATGGTGTGTGGGGACATCCCCTTCGAGCAGGACGAG
GAGATCCTCCGAGGCCGCCTGCTCTTCCGGAGGAGGGTCTCTCCAGAGTGCCAGCAGCTG
ATCCGGTGGTGCCTGTCCCTGCGGCCCTCAGAGCGGCCGTCGCTGGATCAGATTGCGGCC
CATCCCTGGATGCTGGGGGCTGACGGGGGCGTCCCGGAGAGCTGTGACCTGCGGCTGTGC
ACCCTCGACCCTGATGACGTGGCCAGCACCACGTCCAGCAGCGAGAGCTTGTGAGGAGCT
GCACCTGACTGGGAGCTAGGGGACCACCTGCCTTGGCCAGACCTGGGACGCCCCCAGACC
CTGACTTTCTCCTGCGTGGGCCGTCTCCTCCTGCGGAAGCAGTGACCTCTGACCCCTGGT
GACCTTCGCTTTGAGTGCCTTTTGAACGCTGGTCCCGCGGGACTTGGTTTTCTCAAGCTC
TGTCTGTCCAAAGACGCTCCGGTCGAGGTCCCGCCTGCCCTGGGTGGATACTTGAACCCC
AGACGCCCCTCTGTGCTGCTGTGTCCGGAGGCGGCCTTCCCATCTGCCTGCCCACCCGGA
GCTCTTTCCGCCGGCGCAGGGTCCCAAGCCCACCTCCCGCCCTCAGTCCTGCGGTGTGCG
TCTGGGCACGTCCTGCACACACAATGCAAGTCCTGGCCTCCGCGCCCGCCCGCCCACGCG
AGCCGTACCCGCCGCCAACTCTGTTATTTATGGTGTGACCCCCTGGAGGTGCCCTCGGCC
CACCGGGGCTATTTATTGTTTAATTTATTTGTTGAGGTTATTTCCTCTGAGCAGTCTGCC
TCTCCCAAGCCCCAGGGGACAGTGGGGAGGCAGGGGAGGGGGTGGCTGTGGTCCAGGGAC
CCCAGGCCCTGATTCCTGTGCCTGGCGTCTGTCCCGGCCCCGCCTGTCAGAAGATGAACA
TGTATAGTGGCTAACTTAAGGGGAGTGGGTGACCCTGACACTTCCAGGCACTGTGCCCAG
GGTTTGGGTTTTAAATTATTGACTTTGTACAGTCTGCTTGTGGGCTCTGAAAGCTGGGGT
GGGGCCAGAGCCTGAGCGTTTAATTTATTCAGTACCTGTGTTTGTGTGAATGCGGTGTGT
GCAGGCATCGCAGATGGGGGTTCTTTCAGTTCAAAAGTGAGATGTCTGGAGATCATATTT
TTTTATACAGGTATTTCAATTAAAATGTTTTTGTACATAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

Protein Sequence

>415116 : length: 326
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRI
ADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFL
LVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDL
RSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVC
GDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGV
PESCDLRLCTLDPDDVASTTSSSESL