ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4142

Name

MAS1

Synonym

MAS|MGRA;MAS1 proto-oncogene, G protein-coupled receptor;MAS1;MAS1 proto-oncogene, G protein-coupled receptor

Definition

MAS1 oncogene|Mas-related G protein-coupled receptor A|proto-oncogene Mas

Position

6q25.3-q26

Gene Type

protein-coding

Pathways and Diseases

Pathway

Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080

Pathway

Renin-angiotensin system;KEGG PATHWAY;hsa04614

External Links

Links to cell senescence gene database

4142

Links to epithelial mesenchymal transition gene database

4142

Links to ovarian cancer gene database

4142

Links to endometrial cancer gene database

4142

Links to iHOP

4142

Sequence Information

Nucleotide Sequence

>4142 : length: 1135
CCTGAGGCCTCCTCATGGATGGGTCAAACGTGACATCATTTGTTGTTGAGGAACCCACGA
ACATCTCAACTGGCAGGAACGCCTCAGTCGGGAATGCACATCGGCAAATCCCCATCGTGC
ACTGGGTCATTATGAGCATCTCCCCAGTGGGGTTTGTTGAGAATGGGATTCTCCTCTGGT
TCCTGTGCTTCCGGATGAGAAGAAATCCCTTCACTGTCTACATCACCCACCTGTCTATCG
CAGACATCTCACTGCTCTTCTGTATTTTCATCTTGTCTATCGACTATGCTTTAGATTATG
AGCTTTCTTCTGGCCATTACTACACAATTGTCACATTATCAGTGACTTTTCTGTTTGGCT
ACAACACGGGCCTCTATCTGCTGACGGCCATTAGTGTGGAGAGGTGCCTGTCAGTCCTTT
ACCCCATCTGGTACCGATGCCATCGCCCCAAGTACCAGTCGGCATTGGTCTGTGCCCTTC
TGTGGGCTCTTTCTTGCTTGGTGACCACCATGGAGTATGTCATGTGCATCGACAGAGAAG
AAGAGAGTCACTCTCGGAATGACTGCCGAGCAGTCATCATCTTTATAGCCATCCTGAGCT
TCCTGGTCTTCACGCCCCTCATGCTGGTGTCCAGCACCATCTTGGTCGTGAAGATCCGGA
AGAACACGTGGGCTTCCCATTCCTCCAAGCTTTACATAGTCATCATGGTCACCATCATTA
TATTCCTCATCTTCGCTATGCCCATGAGACTCCTTTACCTGCTGTACTATGAGTATTGGT
CGACCTTTGGGAACCTACACCACATTTCCCTGCTCTTCTCCACAATCAACAGTAGCGCCA
ACCCTTTCATTTACTTCTTTGTGGGAAGCAGTAAGAAGAAGAGATTCAAGGAGTCCTTAA
AAGTTGTTCTGACCAGGGCTTTCAAAGATGAAATGCAACCTCGGCGCCAGAAAGACAATT
GTAATACGGTCACAGTTGAGACTGTCGTCTAAGAACTGTGAGGGAAGTTGTGGATAAAAA
TGGTGGAACACAGGTCATTTTTAGTTTGTGCTTGGAATATGACTTAAGTATCTCCTAAAT
GTGATACAGAAGAACATCTCATCCCATATGCATGAGATACTAATTAATGATGAAA

Protein Sequence

>4142 : length: 325
MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR
MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL
YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS
RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF
AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT
RAFKDEMQPRRQKDNCNTVTVETVV