ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

414060

Name

TBC1D3C

Synonym

TBC1D3D;TBC1 domain family, member 3C;TBC1D3C;TBC1 domain family, member 3C

Definition

Rab GTPase-activating protein PRC17|TBC1 domain family member 3C|TBC1 domain family member 3C-like protein ENSP00000341742|TBC1 domain family member 3C/3D

Position

17q12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

414060

Links to epithelial mesenchymal transition gene database

414060

Links to ovarian cancer gene database

414060

Links to endometrial cancer gene database

414060

Links to iHOP

414060

Sequence Information

Nucleotide Sequence

>414060 : length: 3571
GTGACCTGCTCTCTTCCCTCCAGGCGGACTTGGGGGCAGTGGCTACGGTGCGGGCGGTGT
TGGCCTCTGTGGGGCAGCTACCGAGGAGGGTCATCCCTGAGCACTCACCAGGCGCCCGTT
CTACACTGCCCGTGTAGACGATTGGCTCTTTCGTCTCCATGGTGGCTTCGTAGAGTGGGT
GCTGTTCCCAAATGTCCCCATTCGACAGATGAGACGTCTGGGGTCAGAGAGGCAGTAACC
GGCCTGGGAATCCGGACATGACCCTGAGTTTTGCTCTCAGCCCTGCCGTGTGCTGTGCTG
GAATTCAGGCCTGAACCCTGTGACCTCCCTGCCCTAGATCCCAAATCTGCCCAGGTTTCC
CATCCCGATGGGGCAGAGCCTGGTCCTGGCAGAGCCACTGGTATAGAGCCACTGGTACAG
ATCCACTGACGGTCCTCAGAACACCTCTGTGCCCTAAGCTGGGTCCTGATGGTCGCTGTG
GGCCCCACTGAACACACATGGTCCCTTGTCCGGGGGAGCCTGCTGCCCTTGGGCAGCTGT
GGAAAATGAAGGAGCCCTGGAGGGCTGGCTGAGGGGAGACTATCTTCCCTTGTGTTCAAA
GGGGTCCGGGCACTAGGGTTCTCCCCAGGTATTTCTTGCTCTGCGTGGTCCTCTTGAGGC
CTCGCCCTCCTTTTGCCTCGAGTATTCCCAGGAGGGACGGTCCATCCAGCTGTTCTCCAG
GACCAAGGACCCACTGTTCTTCCTCAGTGACCCAGGAAAATGAAGCCTCCTCCTGTTGGG
ACGGCTCAGAATGGTGGACTCCACAGTCCCTCCGCGAGAGACGTGGTTTCCATGCGTACA
ATAGATCTTTCTCATCCCCCAAACCCAACACCCTCCTGCTCAACAGGCGTTATTCCTAAA
GTGGCTTCACTGTTCAGACTGAAGAGCCACGGTAGCCAAAGTGATGAGCGGAGTAGAACC
GAGCAGTCGGGAGAGATCTTGTTCCCTGTAGGAAACTGGGCATCGCTGAGGCCCTGAGCA
TCCCAGGAGGCCGATTGCACAGAGACCTCTGGTCGCTGACCCCAGTCTGCCTCCACATCC
CTGGAATAGCCCATCATGGGCCCTTCACCCTTGGCAGGTGGAAACCATTCAACCTGCTGG
GGCCGGTGTGTCCCCATTTCATGGCATTGGGGGACAACAGGATTCTCTGTCTAGGTCCCA
CTGTACTCAAGTCCTTGGGAAGATGCCCACCCCTGCTTGGGACTTGAGACTCCAGAGACT
GGAGCAGCTGTGGGCCACTGGGTCTGGCCCCTTTTTCCCTGGGGGCGGCGGTGGAATGGG
GGTTACGCAGCCAGCCAGCATCTGGGAGCCCGGCGAGAGCGGTTCAGGTGTTCTCCGAAG
CCGCCGCGTACGGTGTGACCTTTAGACAATTCTGTCTCACAGGATGGACGTGGTAGAGGT
CGCGGGCAGTTGGTGGGCACAAGAGCGAGAGGACATCATTATGAAATACGAAAAGGGACA
CCGAGCTGGGCTGCCAGAGGACAAGGGGCCTAAGCCTTTTCGAAGCTACAACAACAACGT
CGATCATTTGGGGATTGTACAGTCCTGCCCCTCCTGGGAGTCAGCCCCACAGGAAGGCCC
TTGTCCTCCCTTCCCTGTGCCTTCTCCTGGGCTGAGCCCTGAGCTGGAAAGGGACAGAGC
CAGTCCTTTCTGGGGGTCGGCACCCAGGCTGGGGCCGCTCCAGGCCCCGTGCAGTTCCTC
AGCTCTGCCTGGGTTGCCTTACAGTGAGACGGAGCTGCCTCCTCTGACTGCGCGGGAGGC
GAAGCAAATTCGGCGGGAGATCAGCCGAAAGAGCAAGTGGGTGGATATGCTGGGAGACTG
GGAGAAATACAAAAGCAGCAGAAAGCTCATAGATCGAGCGTACAAGGGAATGCCCATGAA
CATCCGGGGCCCGATGTGGTCAGTCCTCCTGAACACTGAGGAAATGAAGTTGAAAAACCC
CGGAAGATACCAGATCATGAAGGAGAAGGGCAAGAGGTCATCTGAGCACATCCAGCGCAT
CGACCGGGACGTAAGCGGGACATTAAGGAAGCATATATTCTTCAGGGATCGATACGGAAC
CAAGCAGCGGGAACTACTCCACATCCTCCTGGCATATGAGGAGTACAACCCGGAGGTGGG
CTACTGCAGGGACCTGAGCCACATCGCCGCCTTGTTCCTCCTCTATCTTCCTGAGGAGGA
TGCATTCTGGGCACTGGTGCAGCTGCTGGCCAGTGAGAGGCACTCCCTGCAGGGATTTCA
CAGCCCAAATGGCGGGACCGTCCAGGGGCTCCAAGACCAACAGGAGCATGTGGTAGCCAC
GTCACAACCCAAGACCATGGGGCATCAGGACAAGAAAGATCTATGTGGGCAGTGTTCCCC
GTTAGGCTGCCTCATCCGGATATTGATTGACGGGATCTCTCTCGGGCTCACCCTGCGCCT
GTGGGACGTGTATCTGGTAGAAGGCGAACAGGCGTTGATGCCGATAACAAGAATCGCCTT
TAAGGTTCAGCAGAAGCGCCTCACGAAGACGTCCAGGTGTGGCCCGTGGGCACGTTTTTG
CAACCGGTTCGTTGATACCTGGGCCAGGGATGAGGACACTGTGCTCAAGCATCTTAGGGC
CTCTATGAAGAAACTAACAAGAAAGAAGGGGGACCTGCCACCCCCAGCCAAACCCGAGCA
AGGGTCGTCGGCATCCAGGCCTGTGCCGGCTTCACGTGGCGGGAAGACCCTCTGCAAGGG
GGACAGGCAGGCCCCTCCAGGCCCACCAGCCCGGTTCCCGCGGCCCATTTGGTCAGCTTC
CCCGCCACGGGCACCTCGTTCTTCCACACCCTGTCCTGGTGGGGCTGTCCGGGAAGACAC
CTACCCTGTGGGCACTCAGGGTGTGCCCAGCCCGGCCCTGGCTCAGGGAGGACCTCAGGG
TTCCTGGAGATTCCTGCAGTGGAACTCCATGCCCCGCCTCCCAACGGACCTGGACGTAGA
GGGCCCTTGGTTCCGCCATTATGATTTCAGACAGAGCTGCTGGGTCCGTGCCATATCCCA
GGAGGACCAGCTGGCCCCCTGCTGGCAGGCTGAACACCCTGCGGAGCGGGTGAGATCGGC
TTTCGCTGCACCCAGCACTGATTCCGACCAGGGCACCCCCTTCAGAGCTAGGGACGAACA
GCAGTGTGCTCCCACCTCAGGGCCTTGCCTCTGCGGCCTCCACTTGGAAAGTTCTCAGTT
CCCTCCAGGCTTCTAGAAGCATCTGGGCCAGGGCTCATGGCTGGATAATTTCCCTAGGCT
TAACAACCCAAGCAAGCTTCGCATCCTCGTTTTATTTTTGGTTAAACTTATGAAAATGTA
TTAAGAAAGAGTGCAGCTCGAGAGAGATTCAGAGATGGAACACACCAGACCCCAGATCAC
AAAGCCAACCATGCCCAGCCCCTCCCAGCACCCCCAGCCCCACGACCATCGTTCTGAATT
CTGACGACACCGTGAGCCTACCTTTGTACTTCAAACTCATGGAAGGATAACCACCTTCAT
GTTTTGAAATAAATGTTTCCTGTTGAAATGA

Protein Sequence

>414060 : length: 610
MDVVEVAGSWWAQEREDIIMKYEKGHRAGLPEDKGPKPFRSYNNNVDHLGIVQSCPSWES
APQEGPCPPFPVPSPGLSPELERDRASPFWGSAPRLGPLQAPCSSSALPGLPYSETELPP
LTAREAKQIRREISRKSKWVDMLGDWEKYKSSRKLIDRAYKGMPMNIRGPMWSVLLNIEE
MKLKNPGRYQIMKEKGKRSSEHIQRIDRDISGTLRKHMFFRDRYGTKQRELLHILLAYEE
YNPEVGYCRDLSHIAALFLLYLPEEDAFWALVQLLASERHSLQGFHSPNGGTVQGLQDQQ
EHVVATSQSKTMGHQDKKDLCGQCSPLGCLIRILIDGISLGLTLRLWDVYLVEGEQALMP
ITRIAFKVQQKRLTKTSRCGPWARFCNRFVDTWARDEDTVLKHLRASMKKLTRKQGDLPP
PAKPEQGSSASRPVPASRGGKTLCKGDRQAPPGPPAWFPRPIWSASPPRAPRSSTPCPGG
AVREDTYPVGTQGVPSPALAQGGPQGSWRFLQWNSMPRLPTDLDVEGPWFRHYDFRQSCW
VRAISQEDQLAPCWQAEHPAERVRSAFAAPSTDSDQGTPFRARDEQQCAPTSGPCLCGLH
LESSQFPPGF