ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4110

Name

MAGEA11

Synonym

CT1.11|MAGE-11|MAGE11|MAGEA-11;melanoma antigen family A11;MAGEA11;melanoma antigen family A11

Definition

MAGE-11 antigen|cancer/testis antigen 1.11|cancer/testis antigen family 1, member 11|melanoma antigen family A, 11|melanoma-associated antigen 11

Position

Xq28

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4110

Links to epithelial mesenchymal transition gene database

4110

Links to ovarian cancer gene database

4110

Links to endometrial cancer gene database

4110

Links to iHOP

4110

Sequence Information

Nucleotide Sequence

>4110 : length: 2514
GGCCCTTGGAGTTCCAAGGCACGGTGGCCACATGTGGTGCATCCTCACTCTGCCTTTGGG
GTGTCAGCAAGGAGTGGGTTGTGGTCTGAGGAGTGGAGCCTCAGGTCAACCCAGGGAGGA
GTCCCAGAGGGAGGACTCAGGCAACCAATTATCCCTGAGGTAGAAAACCTGCCCCTGCCA
TCGGTCCTTGGAGGCCCCAAGCAGGACTCTAGGAAAGAGAGGCAGCTCCCCACTTCCTAG
TTGGGGTTCTCTGGGAGATGGTGGTCGTGGCCTGCAAAACTCATCCACAGTTCAGCAGGA
GAGACATGGATAGGCCTTGTCAGGAGTAAATCTGAATACCTGGAGGAAACCCAGAGAGAG
GAGGCACCCCTGAAATCTGCTTCATCTGTCAGCCTTTGGCATCCCATGAGGGGTGTCCAT
GTAGTGCCCCTTCACTTTCTGCCTCCCATATCTCAGAGAGGTGGGGCCCTTGGTCTGAGG
CAGGTCCTCAGGTCAGCAGAGGGATACACACCTGGTCAGCACAGGGTGGAGTCCAGGATC
TGCCAGTAGTCAAGGAGAGGAAAATTGATGAAGACTGAAGGTAAGAATGTACCCTCCCAC
ATGCCAAAGAAAAAGGGACCTCACCAATCCTTGCTTCCTCTGTTTTCATCCCTCGGAGGC
CCAAGTTGGGGAGGCATGTGCCATGCTCACATTTCTGCCACGAGGTTGGGGGTGGCACCT
TGCTCAGGGAGGTGAGCACCTTGTTTCAAGGGGGTGATGACAGGTCAGCAGGTGGAGCCA
CACCTGATCAGCAGAGGGAGGAGTCCCAGGATCTTTAGGACTCAAGGTGTGAGCACTATG
TTCTCAGAGGACGACTTCCAGTCAACAGAAAGAGCCCCATATGGTCCACAACTACAGTGG
TCCCAGGATCTGCCAAGAGTCCAGGTTTTTAGAGAACAGGCCAACCTGGAGGACAGGAGT
CCCAGGAGAACCCAGAGGATCACTGGAGGAGAACAAGTGCTGTGGGGCCCCATCACCCAG
ATATTTCCCACAGTTCGGCCTGCTGACCTAACCAGAGTCATCATGCCTCTTGAGCAAAGA
AGTCAGCACTGCAAGCCTGAGGAAGGCCTTCAGGCCCAAGAAGAAGACCTGGGCCTGGTG
GGTGCACAGGCTCTCCAAGCTGAGGAGCAGGAGGCTGCCTTCTTCTCCTCTACTCTGAAT
GTGGGCACTCTAGAGGAGTTGCCTGCTGCTGAGTCACCAAGTCCTCCCCAGAGTCCTCAG
GAAGAGTCCTTCTCTCCCACTGCCATGGATGCCATCTTTGGGAGCCTATCTGATGAGGGC
TCTGGCAGCCAAGAAAAGGAGGGGCCAAGTACCTCGCCTGACCTGATAGACCCTGAGTCC
TTTTCCCAAGATATACTACATGACAAGATAATTGATTTGGTTCATTTATTGCTCCGCAAG
TATCGAGTCAAGGGGCTGATCACAAAGGCAGAAATGCTGGGGAGTGTCATCAAAAATTAT
GAGGACTACTTTCCTGAGATATTTAGGGAAGCCTCTGTATGCATGCAACTGCTCTTTGGC
ATTGATGTGAAGGAAGTGGACCCCACTAGCCACTCCTATGTCCTTGTCACCTCCCTCAAC
CTCTCTTATGATGGCATACAGTGTAATGAGCAGAGCATGCCCAAGTCTGGCCTCCTGATA
ATAGTCCTGGGTGTAATCTTCATGGAGGGGAACTGCATCCCTGAAGAGGTTATGTGGGAA
GTCCTGAGCATTATGGGGGTGTATGCTGGAAGGGAGCACTTCCTCTTTGGGGAGCCCAAG
AGGCTCCTTACCCAAAATTGGGTGCAGGAAAAGTACCTGGTGTACCGGCAGGTGCCCGGC
ACTGATCCTGCATGCTATGAGTTCCTGTGGGGTCCAAGGGCCCACGCTGAGACCAGCAAG
ATGAAAGTTCTTGAGTACATAGCCAATGCCAATGGGAGGGATCCCACTTCTTACCCATCC
CTGTATGAAGATGCTTTGAGAGAGGAGGGAGAGGGAGTCTGAGCATGAGATGCAACCAGG
GCCAGCGGGCAGGGAAATGGGCCAATGCATGCTTCAGGGCCACACCCAGCAGTTTCCCTG
TCCTGTGTGAAATCAGGCCCATTCTTCCCTCTGTGTTTGATGAGAGAAGTCAGTGTTCTC
AGTAGTAGAAGGCACAGTGAATGGAAGGGAACACATTGTATACTGCCTTTAGGTTTCTCT
TCCATCGGGTGACTTGGAGATTTCTTTTTGTTTCCCTTTGGTAATTTTCAAATATTGTTC
CTGTAATAAAAGTTTTAGTTAGCTTCAACATCTAAGTGTATGGATGATACTGACCACACA
TGTTGTTTTGCTTATCCATTTCAAGTGCAAGTGTTTGCCATTTTGTAAAACATTTTGGGA
AATCTTCCATCTTGCTGTGATTTGCAATAGGTATTTTCTTGGAGAATGTAAGAACTTAAC
AATAAAGCTGAACTGGTGTTGTGAAACAGAGAAATAAAAGGAGAAGGTCATTAA

Protein Sequence

>4110 : length: 429
METQFRRGGLGCSPASIKRKKKREDSGDFGLQVSTMFSEDDFQSTERAPYGPQLQWSQDL
PRVQVFREQANLEDRSPRRTQRITGGEQVLWGPITQIFPTVRPADLTRVIMPLEQRSQHC
KPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESF
SPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVK
GLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYD
GIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLT
QNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYED
ALREEGEGV