ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4094

Name

MAF

Synonym

CCA4|CTRCT21|c-MAF;v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog;MAF;v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog

Definition

Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene|T lymphocyte c-maf long form|c-maf proto-oncogene|proto-oncogene c-Maf|transcription factor Maf

Position

16q22-q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

gata3 participate in activating the th2 cytokine genes expression;PID BioCarta;100157

Disease

Height;NHGRI

Disease

Multiple myeloma;KEGG DISEASE;H00010

Disease

Cancers;KEGG DISEASE

Disease

Bone disease;FunDO

Disease

Cataract, pulverulent or cerulean, with or without microcornea;OMIM

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Multiple myeloma;FunDO

Disease

Asthma;FunDO

Disease

Neoplasm metastasis;FunDO

Disease

obesity;GAD

Disease

Obesity;NHGRI

Disease

Colon cancer;FunDO

Disease

Nephrosis;FunDO

Disease

METABOLIC;GAD

External Links

Links to cell senescence gene database

4094

Links to epithelial mesenchymal transition gene database

4094

Links to ovarian cancer gene database

4094

Links to endometrial cancer gene database

4094

Links to iHOP

4094

Sequence Information

Nucleotide Sequence

>4094 : length: 6887
GAGGCTTTAAAATCTTTTTTCATCTTCTAGCTGTAGCTCGGGCTGCTTGTCGGCTTGGCC
TCCCCCTCCCCCCTTTGCTCTCTGCCTCGTCTTTCCCCAGGACTTCGCTATTTTGCTTTT
TTAAAAAAAGGCAAGAAAGAACTAAACTCCCCCCTCCCTCTCCTCCAGTCGGGCTGCACC
TCTGCCTTGCACTTTGCACAGAGGTAGAGAGCGCGCGAGGGAGAGAGAGGAAAGAAAAAA
AATAATAAAGAGAGCCAAGCAGAAGAGGAGGCGAGAAGCATGAAGTGTTAACTCCCCCGT
GCCAAGGCCCGCGCCGCCCGGACAGACGCCCGCCGCGCCTCCAGCCCCGAGCGGACGCCG
CGCGCGCCCTGCCTGCAGCCCGGGCCGGCGAGGCGAGCCCTTCCTTATGCAAAGCGCGCA
GCGGAGCGGCGAGCGGGGGACGCCGCGCACCGGGCCGGGCTCCTCCAGCTTCGCCGCCGC
AGCCACCACCGCCGCCACCGCAGCTCGCGGAGGATCTTCCCGAGCCTGAAGCCGCCGGCT
CGGCGCGCAAGGAGGCGAGCGAGCAAGGAGGGGCCGGGGCGAGCGAGGGAGCACATTGGC
GTGAGCAGGGGGGAGGGAGGGCGGGCGCGGGGGGCGCGGGCAGGGCGGGGGGGTGTGTGT
GTGAGCGCGCTCGGAGGTTTCGGGCCAGCCACCGCCGCGCAAGCTAGAAGCGCCCCAGCC
CGGCAAGCTGGCTCACCCGCTGGCCACCCAGCACAGCCCGCTGGCCCCTCTCCTGCAGCC
CATCTGGCGGAGCGGCGGCGGCGGCGGCGGCGGCGGCAGGAGAATGGCATCAGAACTGGC
AATGAGCAACTCCGACCTGCCCACCAGTCCCCTGGCCATGGAATATGTTAATGACTTCGA
TCTGATGAAGTTTGAAGTGAAAAAGGAACCGGTGGAGACCGACCGCATCATCAGCCAGTG
CGGCCGTCTCATCGCCGGGGGCTCGCTGTCCTCCACCCCCATGAGCACGCCGTGCAGCTC
GGTGCCCCCTTCCCCCAGCTTCTCGGCGCCCAGCCCGGGCTCGGGCAGCGAGCAGAAGGC
GCACCTGGAAGACTACTACTGGATGACCGGCTACCCGCAGCAGCTGAACCCCGAGGCGCT
GGGCTTCAGCCCCGAGGACGCGGTCGAGGCGCTCATCAGCAACAGCCACCAGCTCCAGGG
CGGCTTCGATGGCTACGCGCGCGGGGCGCAGCAGCTGGCCGCGGCGGCCGGGGCCGGTGC
CGGCGCCTCCTTGGGCGGCAGCGGCGAGGAGATGGGCCCCGCCGCCGCCGTGGTGTCCGC
CGTGATCGCCGCGGCCGCCGCGCAGAGCGGCGCGGGCCCGCACTACCACCACCACCACCA
CCACGCCGCCGGCCACCACCACCACCCGACGGCCGGCGCGCCCGGCGCCGCGGGCAGCGC
GGCCGCCTCGGCCGGTGGCGCTGGGGGCGCGGGCGGCGGTGGCCCGGCCAGCGCTGGGGG
CGGCGGCGGCGGCGGCGGCGGCGGAGGCGGCGGGGGCGCGGCGGGGGCGGGGGGCGCCCT
GCACCCGCACCACGCCGCCGGCGGCCTGCACTTCGACGACCGCTTCTCCGACGAGCAGCT
GGTGACCATGTCTGTGCGCGAGCTGAACCGGCAGCTGCGCGGGGTCAGCAAGGAGGAGGT
GATCCGGCTGAAGCAGAAGAGGCGGACCCTGAAAAACCGCGGCTATGCCCAGTCCTGCCG
CTTCAAGAGGGTGCAGCAGAGACACGTCCTGGAGTCGGAGAAGAACCAGCTGCTGCAGCA
AGTCGACCACCTCAAGCAGGAGATCTCCAGGCTGGTGCGCGAGAGGGACGCGTACAAGGA
GAAATACGAGAAGTTGGTGAGCAGCGGCTTCCGAGAAAACGGCTCGAGCAGCGACAACCC
GTCCTCTCCCGAGTTTTTCATGTGAGTCTGACACGCGATTCCAGCTAGCCACCCTGATAA
GTGCTCCGCGGGGGTCCGGCTCGGGTGTGGGCTTGCTAGTTCTAGAGCCATGCTCGCCAC
CACCTCACCACCCCCACCCCCACCGAGTTTGGCCCCCTTGGCCCCCTACACACACACAAA
CCCGCACGCACACACCACACACACACACACACACACACACACACCCCACACCCTGCTCGA
GTTTGTGGTGGTGGTGGCTGTTTTAAACTGGGGAGGGAATGGGTGTCTGGCTCATGGATT
GCCAATCTGAAATTCTCCATAACTTGCTAGCTTGTTTTTTTTTTTTTTTTACACCCCCCC
GCCCCACCCCCGGACTTGCACAATGTTCAATGATCTCAGCAGAGTTCTTCATGTGAAACG
TTGATCACCTTTGAAGCCTGCATCATTCACATATTTTTTCTTCTTCTTCCCCTTCAGTTC
ATGAACTGGTGTTCATTTTCTGTGTGTGTGTGTGTTTTATTTTGTTTGGATTTTTTTTTT
TAATTTTACTTTTAGAGCTTGCTGTGTTGCCCACCTTTTTTCCAACCTCCACCCTCACTC
CTTCTCAACCCATCTCTTCCGAGATGAAAGAAAAAAAAAAGCAAAGTTTTTTTTTCTTCT
CCTGAGTTCTTCATGTGAGATTGAGCTTGCAAAGGAAAAAAAAATGTGAAATGTTATAGA
CTTGCAGCGTGCCGAGTTCCATCGGGTTTTTTTTTTAGCATTGTTATGCTAAAATAGAGA
AAAAAATCCTCATGAACCTTCCACAATCAAGCCTGCATCAACCTTCTGGGTGTGACTTGT
GAGTTTTGGCCTTGTGATGCCAAATCTGAGAGTTTAGTCTGCCATTAAAAAAACTCATTC
TCATCTCATGCATTATTATGCTTGCTACTTTGTCTTAGCAACAATGAACTATAACTGTTT
CAAAGACTTTATGGAAAAGAGACATTATATTAATAAAAAAAAAAAGCCTGCATGCTGGAC
ATGTATGGTATAATTATTTTTTCCTTTTTTTTTCCTTTTGGCTTGGAAATGGACGTTCGA
AGACTTATAGCATGGCATTCATACTTTTGTTTTATTGCCTCATGACTTTTTTGAGTTTAG
AACAAAACAGTGCAACCGTAGAGCCTTCTTCCCATGAAATTTTGCATCTGCTCCAAAACT
GCTTTGAGTTACTCAGAACTTCAACCTCCCAATGCACTGAAGGCATTCCTTGTCAAAGAT
ACCAGAATGGGTTACACATTTAACCTGGCAAACATTGAAGAACTCTTAATGTTTTCTTTT
TAATAAGAATGACGCCCCACTTTGGGGACTAAAATTGTGCTATTGCCGAGAAGCAGTCTA
AAATTTATTTTTTAAAAAGAGAAACTGCCCCATTATTTTTGGTTTGTTTTATTTTTATTT
TATATTTTTTGGCTTTTGGTCATTGTCAAATGTGGAATGCTCTGGGTTTCTAGTATATAA
TTTAATTCTAGTTTTTATAATCTGTTAGCCCAGTTAAAATGTATGCTACAGATAAAGGAA
TGTTATAGATAAATTTGAAAGAGTTAGGTCTGTTTAGCTGTAGATTTTTTAAACGATTGA
TGCACTAAATTGTTTACTATTGTGATGTTAAGGGGGGTAGAGTTTGCAAGGGGACTGTTT
AAAAAAAGTAGCTTATACAGCATGTGCTTGCAACTTAAATATAAGTTGGGTATGTGTAGT
CTTTGCTATACCACTGACTGTATTGAAAACCAAAGTATTAAGAGGGGAAACGCCCCTGTT
TATATCTGTAGGGGTATTTTACATTCAAAAATGTATGTTTTTTTTTCTTTTCAAAATTAA
AGTATTTGGGACTGAATTGCACTAAGATATAACCTGCAAGCATATAATACAAAAAAAAAT
TGCAAAACTGTTTAGAACGCTAATAAAATTTATGCAGTTATAAAAATGGCATTACTGCAC
AGTTTTAAGATGATGCAGATTTTTTTACAGTTGTATTGTGGTGCAGAACTGGATTTTCTG
TAACTTAAAAAAAAATCCACAGTTTTAAAGGCAATAATCAGTAAATGTTATTTTCAGGGA
CTGACATCCTGTCTTTAAAAAGAAATGAAAAGTAAATCTTACCACAATAAATATAAAAAA
ATCTTGTCAGTTACTTTTCTTTTACATATTTTGCTGTGCAAAATTGTTTTATATCTTGAG
TTACTAACTAACCACGCGTGTTGTTCCTATGTGCTTTTCTTTCATTTTCAATTCTGGTTA
TATCAAGAAAAGAATAATCTACAATAATAAACGGCATTTTTTTTTGATTCTGTACTCAGT
TTCTTAGTGTACAGTTTAACTGGGCCCAACAACCTCGTTAAAAGTGTAAAATGCATCCTT
TTCTCCAGTGGAAGGATTCCTGGAGGAATAGGGAGACAGTAATTCAGGGTGAAATTATAG
GCTGTTTTTTGAAGTGAGGAGGCTGGCCCCATATACTGATTAGCAATATTTAATATAGAT
GTAAATTATGACCTCATTTTTTTCTCCCCAAAGTTTTCAGTTTTCAAATGAGTTGAGCCA
TAATTGCCCTTGGTAGGAAAAACAAAACAAAACAGTGGAACTAGGCTTCCTGAGCATGGC
CCTACACTTCTGATCAGGAGCAAAGCCATCCATAGACAGAGGAGCCGGACAAATATGGCG
CATCAGAGGTGGCTTGCGCACATATGCATTGAACGGTAAAGAGAAACAGCGCTTGCCTTT
TCACTAAAGTTGACTATTTTTCCTTCTTCTCTTACACACCGAGATTTTCTTGTTAGCAAG
GCCTGACAAGATTTAACATAAACATGACAAATCATAGTTGTTTGTTTTGTTTTGCTTTTC
TCTTTAACACTGAAGATCATTTGTCTTAAATAGGAAAAAGAAAATCCACTCCTTACTTCC
ATATTTCCAAGTACATATCTGGTTTAAACTATGTTATCAAATCATATTTCACCGTGAATA
TTCAGTGGAGAACTTCTCTACCTGGATGAGCTAGTAATGATTTCAGATCATGCTATCCCC
AGAAATAAAAGCAAAAAATAATACCTGTGTGGAATATAGGCTGTGCTTTGATTTACTGGT
ATTTACCCCAAAATAGGCTGTGTATGGGGGCTGACTTAAAGATCCCTTGGAAAGACTCAA
AACTACCTTCACTAGTAGGACTCCTAAGCGCTGACCTATTTTTAAATGACACAAATTCAT
GAAACTAATGTTACAAATTCATGCAGTTTGCACTCTTAGTCATCTTCCCCTAGCACACCA
ATAGAATGTTAGACAAAGCCAGCACTGTTTTGAAAATACAGCCAAACACGATGACTTTTG
TTTTGTTTTCTGCCGTTCTTAAAAGAAAAAAAGATAATATTGCAACTCTGACTGAAAGAC
TTATTTTTAAGAAAACAGGTTGTGTTTGGTGCTGCTAAGTTCTGGCCAGTTTATCATCTG
GCCTTCCTGCCTATTTTTTACAAAACACGAAGACAGTGTGTAACCTCGACATTTTGACCT
TCCTTTATGTGCTAGTTTAGACAGGCTCCTGAATCCACACTTAATTTTGCTTAACAAAAG
TCTTAATAGTAAACCTCCCCTCATGAGCTTGAAGTCAAGTGTTCTTGACTTCAGATATTT
CTTTCCTTTTTTTTTTTTTTTCCTCATCACAACTAAGAGATACACAAACTCTGAAGAAGC
AGAAATGGAGAGAATGCTTTTAACAAAAAAGCATCTGATGAAAGATTTTAGGCAAACATT
CTCAAAATAAGAGTGATATTCTGGATGTAGTTATTGCAGTTATCTCATGACAAATGAGGC
CTGGATTGGAAGGAAAATATAGTTGTGTAGAATTAAGCATTTTGATAGGAATCTACAAGG
TAGTTGAATATAATAAGCAGGTTTGGGCCCCCAAACTTTAGAAAATCAAATGCAAAGGTG
CTGGCAAAAATGAGGTTTGAGTGGCTGGCTGTAAGAGAAGGTTAACTCCTAGTAAAAGGC
ATTTTTAGAAATAACAATTACTGAAAACTTTGAAGTATAGTGGGAGTAGCAAACAAATAC
ATGTTTTTTTTTTCTTACAAAGAACTCCTAAATCCTGAGTAAGTGCCATTCATTACAATA
AGTCTCTAAATTTAAAAAAAAAAAAATCATATGAGGAAATCTAGCTTTCCCCTTTACGCT
GCGTTTGATCTTTGTCTAAATAGTGTTAAAATTCCTTTCATTCCAATTACAGAACTGAGC
CCACTCGCAAGTTGGAGCCATCAGTGGGATACGCCACATTTTGGAAGCCCCAGCATCGTG
TACTTACCAGTGTGTTCACAAAATGAAATTTGTGTGAGAGCTGTACATTAAAAAAAATCA
TCATTATTATTATTATTTGCAGTCATGGAGAACCACCTACCCCTGACTTCTGTTTAGTCT
CCTTTTTAAATAAAAATTACTGTGTTAGAGAAGAAGGCTATTAAATGTAGTAGTTAACTA
TGCCTCTTGTCTGGGGGTTTCATAGAGACCGGTAGGAAAGCGCACTCCTGCTTTTCGATT
TATGGTGTGTGCAAGTAAACAGGTGCATTGCTTTCAACCTGCCATACTAGTTTTAAAAAT
TCACTGAAATTACAAAGATACATATATATGCATATATATAATGGAAAGTTTCCCGGAATG
CAACAATTAGCATTTTAAAATCATATATAGGCATGCACATTCTAAATAGTACTTTTTCAT
GCTTCATTGTTTCTCTGGCAGATAATTTTACTAAGAAGAAAAATAGATATTCGACTCCCC
TTCCCTAAACAAATCCACGGGCAGAGGCTCCAGCGGAGCCGAGCCCCCTGGTTTTCTCGT
AGGCCCTAGACGGTGTTGCATTTATCAGTGATGTCAAACGTGCTCATTTGTCAGACATAG
CTGTAAATGAAAACAATGTGTGGCAAAATACAAAGTTAAAAAAAAAA

Protein Sequence

>4094 : length: 403
MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPM
STPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISN
SHQLQGGFDGYARGAQQLAAAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAGPH
YHHHHHHAAGHHHHPTAGAPGAAGSAAASAGGAGGAGGGGPASAGGGGGGGGGGGGGGAA
GAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRG
YAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENG
SSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK