ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4070

Name

TACSTD2

Synonym

EGP-1|EGP1|GA733-1|GA7331|GP50|M1S1|TROP2;tumor-associated calcium signal transducer 2;TACSTD2;tumor-associated calcium signal transducer 2

Definition

40kD glycoprotein, identified by monoclonal antibody GA733|cell surface glycoprotein TROP2|cell surface glycoprotein Trop-2|epithelial glycoprotein-1|gastrointestinal tumor-associated antigen GA7331|membrane component chromosome 1 surface marker 1|membran

Position

1p32

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4070

Links to epithelial mesenchymal transition gene database

4070

Links to ovarian cancer gene database

4070

Links to endometrial cancer gene database

4070

Links to iHOP

4070

Sequence Information

Nucleotide Sequence

>4070 : length: 2080
GCGGGTCCCCAGAAGCCTACAGGTGAGTATCGGTTCTCCCCTTCCCGGCTTTCGGTCCGG
AGGAGGCGGGAGCAGCTTCCCTGTTCTGATCCTATCGCGGGCGGCGCAGGGCCGGCTTGG
CCTTCCGTGGGACGGGGAGGGGGGCGGGATGTGTCACCCAAATACCAGTGGGGACGGTCG
GTGGTGGAACCAGCCGGGCAGGTCGGGTAGAGTATAAGAGCCGGAGGGAGCGGCCGGGCG
GCAGACGCCTGCAGACCATCCCAGACGCCGGAGCCCGAGCCCCGACGAGTCCCCGCGCCT
CATCCGCCCGCGTCCGGTCCGCGTTCCTCCGCCCCACCATGGCTCGGGGCCCCGGCCTCG
CGCCGCCACCGCTGCGGCTGCCGCTGCTGCTGCTGGTGCTGGCGGCGGTGACCGGCCACA
CGGCCGCGCAGGACAACTGCACGTGTCCCACCAACAAGATGACCGTGTGCAGCCCCGACG
GCCCCGGCGGCCGCTGCCAGTGCCGCGCGCTGGGCTCGGGCATGGCGGTCGACTGCTCCA
CGCTGACCTCCAAGTGTCTGCTGCTCAAGGCGCGCATGAGCGCCCCCAAGAACGCCCGCA
CGCTGGTGCGGCCGAGTGAGCACGCGCTCGTGGACAACGATGGCCTCTACGACCCCGACT
GCGACCCCGAGGGCCGCTTCAAGGCGCGCCAGTGCAACCAGACGTCGGTGTGCTGGTGCG
TGAACTCGGTGGGCGTGCGCCGCACGGACAAGGGCGACCTGAGCCTACGCTGCGATGAGC
TGGTGCGCACCCACCACATCCTCATTGACCTGCGCCACCGCCCCACCGCCGGCGCCTTCA
ACCACTCAGACCTGGACGCCGAGCTGAGGCGGCTCTTCCGCGAGCGCTATCGGCTGCACC
CCAAGTTCGTGGCGGCCGTGCACTACGAGCAGCCCACCATCCAGATCGAGCTGCGGCAGA
ACACGTCTCAGAAGGCCGCCGGTGACGTGGATATCGGCGATGCCGCCTACTACTTCGAGA
GGGACATCAAGGGCGAGTCTCTATTCCAGGGCCGCGGCGGCCTGGACTTGCGCGTGCGCG
GAGAACCCCTGCAGGTGGAGCGCACGCTCATCTATTACCTGGACGAGATTCCCCCGAAGT
TCTCCATGAAGCGCCTCACCGCCGGCCTCATCGCCGTCATCGTGGTGGTCGTGGTGGCCC
TCGTCGCCGGCATGGCCGTCCTGGTGATCACCAACCGGAGAAAGTCGGGGAAGTACAAGA
AGGTGGAGATCAAGGAACTGGGGGAGTTGAGAAAGGAACCGAGCTTGTAGGTACCCGGCG
GGGCAGGGGATGGGGTGGGGTACCGGATTTCGGTATCGTCCCAGACCCAAGTGAGTCACG
CTTCCTGATTCCTCGGCGCAAAGGAGACGTTTATCCTTTCAAATTCCTGCCTTCCCCCTC
CCTTTTGCGCACACACCAGGTTTAATAGATCCTGGCCTCAGGGTCTCCTTTCTTTCTCAC
TTCTGTCTTGAAGGAAGCATTTCTAAAATGTATCCCCTTTCGGTCCAACAACAGGAAACC
TGACTGGGGCAGTGAAGGAAGGGATGGCATAGCGTTATGTGTAAAAAACAAGTATCTGTA
TGACAACCCGGGATCGTTTGCAAGTAACTGAATCCATTGCGACATTGTGAAGGCTTAAAT
GAGTTTAGATGGGAAATAGCGTTGTTATCGCCTTGGGTTTAAATTATTTGATGAGTTCCA
CTTGTATCATGGCCTACCCGAGGAGAAGAGGAGTTTGTTAACTGGGCCTATGTAGTAGCC
TCATTTACCATCGTTTGTATTACTGACCACATATGCTTGTCACTGGGAAAGAAGCCTGTT
TCAGCTGCCTGAACGCAGTTTGGATGTCTTTGAGGACAGACATTGCCCGGAAACTCAGTC
TATTTATTCTTCAGCTTGCCCTTACTGCCACTGATATTGGTAATGTTCTTTTTTGTAAAA
TGTTTGTACATATGTTGTCTTTGATAATGTTGCTGTAATTTTTTAAAATAAAACACGAAT
TTAATAAAATATGGGAAAGGCACAAACCAGAAAAAAAAAA

Protein Sequence

>4070 : length: 323
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGS
GMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCN
QTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLF
RERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRG
GLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNR
RKSGKYKKVEIKELGELRKEPSL