ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4005

Name

LMO2

Synonym

RBTN2|RBTNL1|RHOM2|TTG2;LIM domain only 2 (rhombotin-like 1);LMO2;LIM domain only 2 (rhombotin-like 1)

Definition

LIM domain only protein 2|LMO-2|T-cell translocation gene 2|T-cell translocation protein 2|cysteine-rich protein TTG-2|rhombotin 2|rhombotin-2|rhombotin-like 1

Position

11p13

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4005

Links to epithelial mesenchymal transition gene database

4005

Links to ovarian cancer gene database

4005

Links to endometrial cancer gene database

4005

Links to iHOP

4005

Sequence Information

Nucleotide Sequence

>4005 : length: 2303
GAATTCGTCCAAACTGAGGATCACAAGTCTCCACATTCTGAGTAGGAGGATGAGGGTCTG
AGTTAGGATTTGGGTCCTGCAGGGCTTGCTAAGGAATCCCCTGATGGCCTAGGATTCCAC
GCAGAGCACATCTGGTGTGAGAGAGCTCGCTGCAAGGGTGAAGGCTCCGCCCTATCAGAT
AGACAACCAGGCCACCAAGAGGCCCAGCCCTCCAAACCCTGGATTTGCAACATCCTCAAA
GAACAGCAACGGGCCTTGAGCAGAATTGAGAAGGAAATACCCCCACCTGCCCTCAGCCGT
TAAGTGGGCTTTGCTATTCACAAGGGCCTCTGGGTGTCCTGGCAGAGAGGGGAGATGGCA
CAGGCACCAGGTGCTAGGGTGCCAGGGCCTCCCGAGAAGGAACAGGTGCAAAGCAGGCAA
TTAGCCCAGAAGGTATCCGTGGGGCAGGCAGCCTAGATCTGATGGGGGAAGCCACCAGGA
TTACATCATCTGCTGTAACAACTGCTCTGAAAAGAAGATATTTTTCAACCTGAACTTGCA
GTAGCTAGTGGAGAGGCAGGAAAAAGGAAATGAAACCAGAGACAGAGGGAAGCTGAGCGA
AAATAGACCTTCCCGAGAGAGGAGGAAGCCCGGAGAGAGACGCACGGTCCCCTCCCCGCC
CCTAGGCCGCCGCCCCCTCTCTGCCCTCGGCGGCGAGCAGCGCGCCGCGACCCGGGCCGA
AGGTGCGAGGGGCTCCGGGCGGCCGGGCGGGCGCACACCATCCCCGCGGGCGGCGCGGAG
CCGGCGACAGCGCGCGAGAGGGACCGGGCGGTGGCGGCGGCGGGACCGGGATGGAAGGGA
GCGCGGTGACTGTCCTTGAGCGCGGAGGGGCGAGCTCGCCGGCGGAGCGCCGGAGCAAGC
GGAGGCGCAGGAGCGGCGGCGACGGCGGCGGCGGCGGCGGCGCCCGAGCACCCGAGGGGG
TCCGAGCCCCGGCAGCCGGCCAGCCCCGCGCCACAAAGGGAGCGCCCCCGCCGCCCGGCA
CCCCGCCTCCCTCCCCAATGTCCTCGGCCATCGAAAGGAAGAGCCTGGACCCTTCAGAGG
AACCAGTGGATGAGGTGCTGCAGATCCCCCCATCCCTGCTGACATGCGGCGGCTGCCAGC
AGAACATTGGGGACCGCTACTTCCTGAAGGCCATCGACCAGTACTGGCACGAGGACTGCC
TGAGCTGCGACCTCTGTGGCTGCCGGCTGGGTGAGGTGGGGCGGCGCCTCTACTACAAAC
TGGGCCGGAAGCTCTGCCGGAGAGACTATCTCAGGCTTTTTGGGCAAGACGGTCTCTGCG
CATCCTGTGACAAGCGGATTCGTGCCTATGAGATGACAATGCGGGTGAAAGACAAAGTGT
ATCACCTGGAATGTTTCAAATGCGCCGCCTGTCAGAAGCATTTCTGTGTAGGTGACAGAT
ACCTCCTCATCAACTCTGACATAGTGTGCGAACAGGACATCTACGAGTGGACTAAGATCA
ATGGGATGATATAGGCCCGAGTCCCCGGGCATCTTTGGGGAGGTGTTCACTGAAGACGCC
GTCTCCATGGCATCTTCGTCTTCACTCTTAGGCACTTTGGGGGTTTGAGGGTGGGGTAAG
GGATTTCTTAGGGGATGGTAGACCTTTATTGGGTATCAAGACATAGCATCCAAGTGGCAT
AATTCAGGGGCTGACACTTCAAGGTGACAGAAGGACCAGCCCTTGAGGGAGAACTTATGG
CCACAGCCCATCCATAGTAACTGACATGATTAGCAGAAGAAAGGAACATTTAGGGGCAAG
CAGGCGCTGTGCTATCATGATGGAATTTCATATCTACAGATAGAGAGTTGTTGTGTACAG
ACTTGTTGTGACTTTGACGCTTGCGAACTAGAGATGTGCAATTGATTTCTTTTCTTCCTG
GCTTTTTAACTCCCCTGTTTCAATCACTGTCCTCCACACAAGGGAAGGACAGAAAGGAGA
GTGGCCATTCTTTTTTTCTTGGCCCCCTTCCCAAGGCCTTAAGCTTTGGACCCAAGGAAA
ACTGCATGGAGACGCATTTCGGTTGAGAATGGAAACCACAACTTTTAACCAAACAATTAT
TTAAAGCAATGCTGATGAATCACTGTTTTTAGACACCTTCATTTTGAGGGGAGGAGTTCC
ACAGATTGTTTCTATACAAATATAAATCTTAAAAAGTTGTTCAACTATTTTATTATCCTA
GATTATATCAAAGTATTTGTCGTGTGTAGAAAAAAAAACAGCTCTGCAGGCTTAATAAAA
ATGACAGACTGAAAAAAAAAAAA

Protein Sequence

>4005 : length: 227
MEGSAVTVLERGGASSPAERRSKRRRRSGGDGGGGGGARAPEGVRAPAAGQPRATKGAPP
PPGTPPPSPMSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWH
EDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVK
DKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI