ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4004

Name

LMO1

Synonym

RBTN1|RHOM1|TTG1;LIM domain only 1 (rhombotin 1);LMO1;LIM domain only 1 (rhombotin 1)

Definition

LIM domain only protein 1|LMO-1|T-cell translocation gene 1|T-cell translocation protein 1|cysteine-rich protein TTG-1|rhombotin-1

Position

11p15

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4004

Links to epithelial mesenchymal transition gene database

4004

Links to ovarian cancer gene database

4004

Links to endometrial cancer gene database

4004

Links to iHOP

4004

Sequence Information

Nucleotide Sequence

>4004 : length: 2281
CTGTTGGACAGATAGGGTGGCTTCCTTCTACACATACTTGCACTGACCACTAGACTGGCC
TTTGGGTGGAGCTGGACTATGGCCAGTGCCAGGGTGACTTTAACCACAGTAGAACAATCA
AATCAGTTCGTTGCTCCTCAAAATAAGTGTCTCTCACTATCCTGTCTCATGTGTTGAGGA
GAGTGACACTAATCAGAGTGAACGTTTTGCTGTGGCCCTTAGTCCTTAGCACATCACATA
AATTAACTCCGTTCTTTCTCATGGTGACTCGGAAATGAGTACTGTTTTCATACCCATTAC
ACAAAAAAAGAAAACTGAGAAAATGTTAATCGAAGTCACACAGTCAAAAGTGTCAGACAA
ACCCACATTGAGAGATATTCCATGAAATGACTGGCCTGTACTCTTCAAAAATGCCATTGT
CTTGAAACACAAAAGAAACGTTTAGGAATTCTTCCAGATGTAAGTAGACTAAACTTGACA
ACTGAATGCGATGCAGGGCCCAGGATTTTTCCATAAAAGATATTTTTGAAGAAATTGGTA
AAATCTGAATGAGGTCTATAGATTAGATAATAATGTTATGTCAATGATAATTTTCTGATT
TCAATTATTATACTGTGGTTATGTAAGAGAATGTCCTTGTTTTCAGCAAAGCATTTGCAA
ACCGAAAGTATTAGGGGGTATAGAGGCTTCCTGTTTGAAACCAACTCTCAAATGATTTAG
GGAAAAAATTATAGGTAAGTAGGTAGAAGTAGGTAGAAAGATGGAGGTTAAATCAAATGT
GGTAAAATGTTATATGTAGGGAATCTGGGTGAAGGGCTTACAGGAATTTTTTCTACTATT
CTTGCAAGTGTTCTGAAAGTTTGAAATTATGTCAAGAGACAAAAAGTTAAAAGAAAAAGA
AAGCAAGTGCCCGAGCAGGGATGGTATCCTGGGGTGACTGTTAATACTATCAGTTCCTGT
TCACTGTGCCCTGGGCACCAGACTCTGTGCTATGGCCTCATGTGCAGAAGAACCTCATTC
TATCCTCACCACATTCTGAGCGGAAAGACCACTGTGGCTCCCAGTACACACATGCCAGTC
AGAAAGGTGGGGGGATTTAATCCAGGCCCCCCAGCTCCTTGGAGCAGTTCCGACTTGAAA
CTAGGCTCCCTGATTTCAAGGTCTGAACTCTTAGCCTCAGTCTCACTCTTGACTCTGACC
TTTTTGGGAGAGTGGGGATGGGCAGGACAAAGGCGTTTCTTCCTGGAGTAGTAGCAGAGT
GAAGGCCCCGGGACACAAGCTAACAAGATCCATTTGCGGGAGGGAGAGGAGCTGTGTTCC
AGGATCCTGCAGGGGGCAGAGCCAGCAGTGCCAAGCAGGAGACACTGGCTTGTGGGAGGG
GCTGCAGATGCCCAGTGGAGTTGCCAGGAGGTGGCCACAGTGGCTTCCAGCAGGGGAGCC
ACGGGGAAGAGCCTGGAGTGACCTGGAGCTGGGTGAGGTAGACGTTCTGGGCTGGAAGAG
TGGCCTTGGAGGAGCTCACTGGGGCGTGCCGATGCTCTCCGTCCAGCCCAAAGGGAAGCA
GAAGGGCTGTGCGGGCTGTAACCGCAAGATCAAGGACCGCTATCTGCTGAAGGCATTGGA
CAAGTACTGGCACGAAGACTGCCTCAAGTGTGCCTGCTGTGACTGCCGCCTGGGCGAGGT
GGGCTCCACCCTCTACACCAAGGCCAACCTCATCCTGTGCCGACGCGACTACCTGAGGCT
CTTTGGCACCACAGGGAACTGTGCTGCTTGCAGCAAGCTGATCCCAGCCTTCGAGATGGT
GATGCGGGCCCGGGACAACGTGTATCACCTCGACTGCTTCGCCTGCCAGCTCTGCAACCA
GAGATTTTGTGTGGGAGACAAATTCTTCCTGAAGAACAACATGATCTTGTGTCAGATGGA
CTATGAGGAAGGGCAGCTCAATGGCACCTTTGAATCCCAAGTTCAGTAACGCCCGGCGCC
TGGCCTCCAGGCCCGTCTGTCCATCTGCCCGCCTGCCCACCTGCCTGGCCGGCCAGCCAG
CCACTCTACCAGTGCAGGCTGGCCAGCCGCTCTCCTGCCACATTAGAACTTCTCCGTCCT
CGATGGGAGGGATGGCCCTTCCTCCTCCACCACCGCCCGTCTGTGTGTGACCCCTCCTGG
GGCCAGGCCGGGCCTGTACAGTCTGTCTTCTGTATATAAATGGGAACATTTATTTTATGA
GAAATGTAATGCGATTTTATTACTGGCGTGGATTAAACTTATGAATGTTTCCGGGAGGTT
A

Protein Sequence

>4004 : length: 193
MPSGVARRWPQWLPAGEPRGRAWSDLELGEVDVLGWKSGLGGAHWGVPMLSVQPKGKQKG
CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFG
TTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYE
EGQLNGTFESQVQ