ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3975

Name

LHX1

Synonym

LIM-1|LIM1;LIM homeobox 1;LHX1;LIM homeobox 1

Definition

LIM homeobox protein 1|LIM/homeobox protein Lhx1|homeobox protein Lim-1

Position

17q12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3975

Links to epithelial mesenchymal transition gene database

3975

Links to ovarian cancer gene database

3975

Links to endometrial cancer gene database

3975

Links to iHOP

3975

Sequence Information

Nucleotide Sequence

>3975 : length: 3724
CAACAGCCAGGAGCAGTGACCAAGCCGCCGGAGCTGGGGAGAGACGCACCGGGGCGGCGA
CTGGGCCAGGAGACCAGGGACTGAGGGACGCGCCCGGGGAGGGCCAGCAACAAGCCGCGG
CCCGGGCGCGACAGCGGCGGTCCGCGCCGAGCCGTTCCAGCCGCCGGCCTACTGTAGCCG
CTGCGCCAGGACATTTTTTTTTAAAGCTCTCCAAGCTGCCCCCCTCCTCCCCGACTCCTC
CCGCTGCAAAAGAAAAACAAAAAAAAAAAAGGAAGGAGGCTAGAAAGGAAACCCAGATTT
GCCACCACAACGAAAAAAAGAAGGGGAAAAGGAAAAGGAGAGAAAGTCGAGCGACTGTGG
GGTTAGACGGAGGCAGACAGAGCGTGGGCCGAGCGATGCGGGGCTGTGCGCCCAGGCGGC
CGCGAGTTGTGACTGGAGCCACGATGCACGGCCAGGCGCGGTGAGAAGCCAGCCCGTAGT
GCCTCCCGAAGGAGCCCGGGCGCAGGGAGGGTCGCCCTGAGGACACGGAGGCCGCCAGGC
AGGCCAAGGGCCGAGCTCTACCTCAAGCCCCGGAGAACTCAGCGGCGCTTTCCTCGCAAC
CCGAGCTCGGCGAGTCGTCGTCTTCTTCTTCTCCGTTTTTATTTATTTATTTCCGTTCCC
GCCGCCGTTCTCGCTGACCTTCACTCCTCCGCGGGCTCTGAGCAGAAGGGTCGCATTCTC
TCCCGCCTGAGACTTCTTTTCCTCGCCCCGGGAGCTCAGGCGGCGCCGCTCCAGCCCGGG
GCCCCGGGACTCCCCGGCTGCACACTTCACTGAGACGCCCCCCCAGGCCCCGATCAGCCT
CGTTTCCTCCACCCTACTTTGATTTCCTGGTGCGAGTTTTGGCTTGCACGGCCGAGTGTG
TGTCCTCTTTTTGGAGAGACTGGGGAGCTCGTGCCGATTGTCTTCAGGAGTCATCCCCTG
GGCTCTACTTTGCCCCTCTCTCTCTCTGGGCCTCATCAGACCAAACCAAAGACCATGGTT
CACTGTGCCGGCTGCAAAAGGCCCATCCTGGACCGCTTTCTCTTGAACGTGCTGGACAGG
GCCTGGCACGTCAAGTGCGTCCAGTGCTGTGAATGTAAATGCAACCTGACCGAGAAGTGC
TTCTCCAGGGAAGGCAAACTCTACTGCAAGAACGACTTCTTCCGGTGTTTCGGTACCAAA
TGCGCAGGCTGCGCTCAGGGCATCTCCCCTAGCGACCTGGTGCGGAGAGCGCGGAGCAAA
GTGTTTCACCTGAACTGCTTCACCTGCATGATGTGTAACAAGCAGCTCTCCACTGGCGAG
GAACTCTACATCATCGACGAGAATAAGTTCGTCTGCAAAGAGGATTACCTAAGTAACAGC
AGTGTTGCCAAAGAGAACAGCCTTCACTCGGCCACCACGGGCAGTGACCCCAGTTTGTCT
CCGGATTCCCAAGACCCGTCGCAGGACGACGCCAAGGACTCGGAGAGCGCCAACGTGTCG
GACAAGGAAGCGGGTAGCAACGAGAATGACGACCAGAACCTGGGCGCCAAGCGGCGGGGA
CCGCGCACCACCATCAAAGCCAAGCAGCTGGAGACGCTGAAGGCCGCCTTCGCTGCTACA
CCCAAGCCCACCCGCCACATCCGCGAGCAGCTGGCGCAGGAGACCGGCCTCAACATGCGC
GTCATTCAGGTCTGGTTCCAGAACCGGCGCTCCAAGGAGCGGAGGATGAAGCAGCTGAGC
GCCCTGGGCGCCCGGCGCCACGCCTTCTTCCGCAGTCCGCGCCGGATGCGGCCGCTGGTG
GACCGCCTGGAGCCGGGCGAGCTCATCCCCAATGGTCCCTTCTCCTTCTACGGAGATTAC
CAGAGCGAGTACTACGGGCCCGGGGGCAACTACGACTTCTTCCCGCAAGGCCCCCCGTCC
TCGCAGGCCCAGACACCAGTGGACCTACCCTTCGTGCCGTCATCTGGGCCGTCCGGGACG
CCCCTGGGTGGCCTGGAGCACCCGCTGCCGGGCCACCACCCGTCGAGCGAGGCGCAGCGG
TTTACCGACATCCTGGCGCACCCACCCGGGGACTCGCCCAGCCCCGAGCCCAGCCTGCCC
GGGCCTCTGCACTCCATGTCGGCCGAGGTCTTCGGACCCAGCCCGCCCTTCTCGTCGCTG
TCGGTCAACGGTGGGGCGAGCTACGGAAACCACCTGTCCCACCCCCCCGAAATGAACGAG
GCGGCCGTGTGGTAGCGGGGTCTCGCACGGTCTGCGGAGTTCGTGGTTGTACAGAAATGA
ACCTTTATTTAAGAAAAATAGAAAAAAAAAAAAACATAAAAAGCAAGTCCCCACCCCCTT
CCTCCAGCCTCGAGAACCATTCTCCTTCTGGGGAGACCGGATGGAAAAGGGGGACACGAA
ATAGGATCCAAATCGGCCTCGAGGTGGGACTGGGATCCGCGCACTGGCTGTCGACGTGCA
GAACTGGGGCTCCCCAAAGGAAACGCAGACCTCTCCCCAACTCCCACCTGGACCCGGATC
CGTAGACAGACCCCGCGGGCGTGTGCGCCTGGCAGGCGGGCGGCGAAAAGACGTCCAGGG
CAGCCGCGGGTGCGCACAGCCGTTGGCGATGCCAGGAGCCGTGGGGAGGGAGGCCGTGAG
CACAGCCGGGTGAAGGAAGTGAAGCGGCCCAGGGCGCTCCCGGGCCAGCCAGGAGGGTTC
TAGCTCTGGGATATCCCTTATTAGTGTTGTCTCAGAGTTCAACAACAGCGACAAAAAACT
CTTATAGCTTCAGAAACGCCGACCTGCCGTGCATCAGGTGGGACTATATATATATTTTTT
GTCTATCTGGATTTTTGGTTTTTGTTTTTGCCAAAATTGCAAAATTCTAAATGTAAAGCC
CTCCGTATCAACTCTTCTACCTTCGCAAAACTACACATACACACATACACACGTACACGG
ACACACTCGGTAAGATGGTCTCCAGCCAGACCGCTCAGTAAAATGACTTGAACATCAGCT
GTACAAGAAAAGTATTCTACCTTCACACACAAAAAGTTAAAAAAAAAAAAAAAAGACTAT
TGAACTAAAAACAGTCAACTGTTTACGTATAATGTTAAATTCAGGAGTTCAGTGTTTTAC
TAATATATCCTGTTTTGAAACCTCTTGTTCGAAAACAAAATGTTTTGAGCAATCAACCAA
AATTGTTCCTTTTCTTTTCCTGTAGATGTTCTGACAGATTTGCAGGGCTTTCGGCTCACT
GTGCTAGTATGTAAAAAGGTGTTGTTTACACGAGGCAAAGAGAAAACATGCTATTCAGAC
AGTTGCCAAATAGAATAATTATAGCACAAATACTGTAAAGGTGCCTGGCACCAGCAACCT
GAGAAAGTGTTAAAAAAAAAAAAAAAAAAGTGTTACAAGATTTAAAAAAAAACATCTTTG
CTAATTTTTTTGTCCTGTTGAACATTCATGGAATTGTTAATATGACTTATATAGACCCAC
ACAGGTTTTATTTTTGTGTCTTTAAAATAAAAGTCCAAAATATTTAAATTTTATGGTCAA
ATATGCAGTCAACAGCTGCTACTTTTTCTTTATATATTAAATTTCTCATATGTCTTTTAT
TGTTCTAATAAACCTAAGCTTGTGTGACCTCCAGTGCATATTAGACCATTCACTGTATGA
AAGAAAACATGTTGAATAAATTTGTGAGTTTTTAATAAAAATAGAAAATCTGATGTTTAG
ATAA

Protein Sequence

>3975 : length: 406
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFG
TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLS
NSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGP
PSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPS
LPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW