ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3945

Name

LDHB

Synonym

HEL-S-281|LDH-B|LDH-H|LDHBD|TRG-5;lactate dehydrogenase B;LDHB;lactate dehydrogenase B

Definition

L-lactate dehydrogenase B chain|LDH heart subunit|epididymis secretory protein Li 281|lactate dehydrogenase H chain|renal carcinoma antigen NY-REN-46

Position

12p12.2-p12.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pyruvate metabolism and Citric Acid (TCA) cycle;Reactome;REACT:1046

Pathway

pyruvate fermentation to lactate;BioCyc;PWY-5481

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Pyruvate metabolism;KEGG PATHWAY;hsa00620

Pathway

Propanoate metabolism;KEGG PATHWAY;hsa00640

Pathway

Cysteine and methionine metabolism;KEGG PATHWAY;hsa00270

Pathway

Glycolysis / Gluconeogenesis;KEGG PATHWAY;hsa00010

Disease

Brain tumor;FunDO

Disease

Lactate dehydrogenase-B deficiency;OMIM

External Links

Links to cell senescence gene database

3945

Links to epithelial mesenchymal transition gene database

3945

Links to ovarian cancer gene database

3945

Links to endometrial cancer gene database

3945

Links to iHOP

3945

Sequence Information

Nucleotide Sequence

>3945 : length: 1539
TCCGCACGACTGTTACAGAGGTCTCCAGAGCCTTCTCTCTCCTGGTAGGTTTCGGCTCAG
GACCCTGAATCCTGGCCCACAGGCAAGCCTGATGGGACGTGCGGGGTAGTACTTGTATGG
GGAGACGCGGGAAGGAGGAAGAAGCACATCTGTCCTCCGCGGCCTTTAGCTCTGAGCATC
CGGCCGCGGGCCCTGACTTTGCCGCTCAGTTTGGGGCGCAGGGGGGGCCGTGCCCTGGCG
GAGGAGCAGAAGGCAGAGGGTAGCAGCTGCGGCTCAGCGGAGAGACTTGTTGCATTTGCA
GCTAAAACCAGGCCCTACTTGTCCTTGTGCAAAATGGCAACTCTTAAGGAAAAACTCATT
GCACCAGTTGCGGAAGAAGAGGCAACAGTTCCAAACAATAAGATCACTGTAGTGGGTGTT
GGACAAGTTGGTATGGCGTGTGCTATCAGCATTCTGGGAAAGTCTCTGGCTGATGAACTT
GCTCTTGTGGATGTTTTGGAAGATAAGCTTAAAGGAGAAATGATGGATCTGCAGCATGGG
AGCTTATTTCTTCAGACACCTAAAATTGTGGCAGATAAAGATTATTCTGTGACCGCCAAT
TCTAAGATTGTAGTGGTAACTGCAGGAGTCCGTCAGCAAGAAGGGGAGAGTCGGCTCAAT
CTGGTGCAGAGAAATGTTAATGTCTTCAAATTCATTATTCCTCAGATCGTCAAGTACAGT
CCTGATTGCATCATAATTGTGGTTTCCAACCCAGTGGACATTCTTACGTATGTTACCTGG
AAACTAAGTGGATTACCCAAACACCGCGTGATTGGAAGTGGATGTAATCTGGATTCTGCT
AGATTTCGCTACCTTATGGCTGAAAAACTTGGCATTCATCCCAGCAGCTGCCATGGATGG
ATTTTGGGGGAACATGGCGACTCAAGTGTGGCTGTGTGGAGTGGTGTGAATGTGGCAGGT
GTTTCTCTCCAGGAATTGAATCCAGAAATGGGAACTGACAATGATAGTGAAAATTGGAAG
GAAGTGCATAAGATGGTGGTTGAAAGTGCCTATGAAGTCATCAAGCTAAAAGGATATACC
AACTGGGCTATTGGATTAAGTGTGGCTGATCTTATTGAATCCATGTTGAAAAATCTATCC
AGGATTCATCCCGTGTCAACAATGGTAAAGGGGATGTATGGCATTGAGAATGAAGTCTTC
CTGAGCCTTCCATGTATCCTCAATGCCCGGGGATTAACCAGCGTTATCAACCAGAAGCTA
AAGGATGATGAGGTTGCTCAGCTCAAGAAAAGTGCAGATACCCTGTGGGACATCCAGAAG
GACCTAAAAGACCTGTGACTAGTGAGCTCTAGGCTGTAGAAATTTAAAAACTACAATGTG
ATTAACTCGAGCCTTTAGTTTTCATCCATGTACATGGATCACAGTTTGCTTTGATCTTCT
TCAATATGTGAATTTGGGCTCACAGAATCAAAGCCTATGCTTGGTTTAATGCTTGCAATC
TGAGCTCTTGAACAAATAAAATTAACTATTGTAGTGTGC

Protein Sequence

>3945 : length: 353
MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKVRQTTTKCNMISRIVFYKKIH
LKRLRPDKIIVQGYFCLSKFYVNYSHFPTEVLDSKGRKLRESKTFNRLLSFFI