ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3934

Name

LCN2

Synonym

24p3|MSFI|NGAL;lipocalin 2;LCN2;lipocalin 2

Definition

25 kDa alpha-2-microglobulin-related subunit of MMP-9|lipocalin-2|migration-stimulating factor inhibitor|neutrophil gelatinase-associated lipocalin|oncogene 24p3|p25|siderocalin LCN2

Position

9q34

Gene Type

protein-coding

External Links

Links to cell senescence gene database

3934

Links to epithelial mesenchymal transition gene database

3934

Links to ovarian cancer gene database

3934

Links to endometrial cancer gene database

3934

Links to iHOP

3934

Sequence Information

Nucleotide Sequence

>3934 : length: 840
ACTCGCCACCTCCTCTTCCACCCCTGCCAGGCCCAGCAGCCACCACAGCGCCTGCTTCCT
CGGCCCTGAAATCATGCCCCTAGGTCTCCTGTGGCTGGGCCTAGCCCTGTTGGGGGCTCT
GCATGCCCAGGCCCAGGACTCCACCTCAGACCTGATCCCAGCCCCACCTCTGAGCAAGGT
CCCTCTGCAGCAGAACTTCCAGGACAACCAATTCCAGGGGAAGTGGTATGTGGTAGGCCT
GGCAGGGAATGCAATTCTCAGAGAAGACAAAGACCCGCAAAAGATGTATGCCACCATCTA
TGAGCTGAAAGAAGACAAGAGCTACAATGTCACCTCCGTCCTGTTTAGGAAAAAGAAGTG
TGACTACTGGATCAGGACTTTTGTTCCAGGTTGCCAGCCCGGCGAGTTCACGCTGGGCAA
CATTAAGAGTTACCCTGGATTAACGAGTTACCTCGTCCGAGTGGTGAGCACCAACTACAA
CCAGCATGCTATGGTGTTCTTCAAGAAAGTTTCTCAAAACAGGGAGTACTTCAAGATCAC
CCTCTACGGGAGAACCAAGGAGCTGACTTCGGAACTAAAGGAGAACTTCATCCGCTTCTC
CAAATCTCTGGGCCTCCCTGAAAACCACATCGTCTTCCCTGTCCCAATCGACCAGTGTAT
CGACGGCTGAGTGCACAGGTGCCGCCAGCTGCCGCACCAGCCCGAACACCATTGAGGGAG
CTGGGAGACCCTCCCCACAGTGCCACCCATGCAGCTGCTCCCCAGGCCACCCCGCTGATG
GAGCCCCACCTTGTCTGCTAAATAAACATGTGCCCTCAGGCCAAAAAAAAAAAAAAAAAA

Protein Sequence

>3934 : length: 198
MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNA
ILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSY
PGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLG
LPENHIVFPVPIDQCIDG