ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3932

Name

LCK

Synonym

IMD22|LSK|YT16|p56lck|pp58lck;LCK proto-oncogene, Src family tyrosine kinase;LCK;LCK proto-oncogene, Src family tyrosine kinase

Definition

T-lymphocyte specific protein tyrosine kinase p56lck|leukocyte C-terminal Src kinase|lymphocyte cell-specific protein-tyrosine kinase|lymphocyte-specific protein tyrosine kinase|p56(LSTRA) protein-tyrosine kinase|proto-oncogene tyrosine-protein kinase LCK

Position

1p34.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Translocation of ZAP-70 to Immunological synapse;PID Reactome;500480

Pathway

Alpha-synuclein signaling;PID Curated;200187

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

role of mef2d in t-cell apoptosis;PID BioCarta;100109

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

Nef and signal transduction;PID Reactome;500755

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

T cell activation;PANTHER;P00053

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Nef Mediated CD4 Down-regulation;PID Reactome;500759

Pathway

Glypican 1 network;PID Curated;200021

Pathway

Primary immunodeficiency;KEGG PATHWAY;hsa05340

Pathway

Atypical NF-kappaB pathway;PID Curated;200017

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Parkinson disease;PANTHER;P00049

Pathway

activation of csk by camp-dependent protein kinase inhibits signaling through the t cell receptor;PID BioCarta;100196

Pathway

Downstream TCR signaling;PID Reactome;500482

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

il 2 signaling pathway;PID BioCarta;100130

Pathway

the co-stimulatory signal during t-cell activation;PID BioCarta;100193

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

PD-1 signaling;PID Reactome;500488

Pathway

Hemostasis;Reactome;REACT:604

Pathway

TCR signaling;PID Reactome;500478

Pathway

Phosphorylation of CD3 and TCR zeta chains;PID Reactome;500479

Pathway

il-7 signal transduction;PID BioCarta;100125

Pathway

lck and fyn tyrosine kinases in initiation of tcr activation;PID BioCarta;100023

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

amb2 Integrin signaling;PID Curated;200108

Disease

Renal Cell cancer;FunDO

Disease

Primary immunodeficiency;KEGG DISEASE

Disease

Lung disease;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Primary tumor;FunDO

Disease

Immune system diseases;KEGG DISEASE

Disease

Lymphoma;FunDO

Disease

Breast cancer;FunDO

Disease

Combined immunodeficiencies;KEGG DISEASE;H00093

Disease

SCID due to LCK deficiency;OMIM

External Links

Links to cell senescence gene database

3932

Links to epithelial mesenchymal transition gene database

3932

Links to ovarian cancer gene database

3932

Links to endometrial cancer gene database

3932

Links to iHOP

3932

Sequence Information

Nucleotide Sequence

>3932 : length: 2143
AAGTCAGGGTGGGACGTGGGCGCGGGGAGACAGGTGGTGGCTACGACGGCGAAGGGAGCT
GAGACTGTCCAGGCAGCCAGGTTAGGCCAGGAGGACCATGTGAATGGGGCCAGAGGGCTC
CCGGGCTGGGCAGGGACCATGGGCTGTGGCTGCAGCTCACACCCGGAAGATGACTGGATG
GAAAACATCGATGTGTGTGAGAACTGCCATTATCCCATAGTCCCACTGGATGGCAAGGGC
ACGCTGCTCATCCGAAATGGCTCTGAGGTGCGGGACCCACTGGTTACCTACGAAGGCTCC
AATCCGCCGGCTTCCCCACTGCAAGGTGACCCCAGGCAGCAGGGCCTGAAAGACAAGGCC
TGCGGATCCCTGGCTGTTGGCTTCCACCTCTCCCCCACCTACTTTCTCCCCGGTCTTGCC
TTCCTTGTCCCCCACCCTGTAACTCCAGGCTTCCTGCCGATCCCAGCTCGGTTCTCCCTG
ATGCCCCTTGTCTTTACAGACAACCTGGTTATCGCTCTGCACAGCTATGAGCCCTCTCAC
GACGGAGATCTGGGCTTTGAGAAGGGGGAACAGCTCCGCATCCTGGAGCAGAGCGGCGAG
TGGTGGAAGGCGCAGTCCCTGACCACGGGCCAGGAAGGCTTCATCCCCTTCAATTTTGTG
GCCAAAGCGAACAGCCTGGAGCCCGAACCCTGGTTCTTCAAGAACCTGAGCCGCAAGGAC
GCGGAGCGGCAGCTCCTGGCGCCCGGGAACACTCACGGCTCCTTCCTCATCCGGGAGAGC
GAGAGCACCGCGGGATCGTTTTCACTGTCGGTCCGGGACTTCGACCAGAACCAGGGAGAG
GTGGTGAAACATTACAAGATCCGTAATCTGGACAACGGTGGCTTCTACATCTCCCCTCGA
ATCACTTTTCCCGGCCTGCATGAACTGGTCCGCCATTACACCAGGTACTACAACGGGCAC
ACGAAGGTGGCGGTGAAGAGCCTGAAGCAGGGCAGCATGTCCCCGGACGCCTTCCTGGCC
GAGGCCAACCTCATGAAGCAGCTGCAACACCAGCGGCTGGTTCGGCTCTACGCTGTGGTC
ACCCAGGAGCCCATCTACATCATCACTGAATACATGGAGAATGGGAGTCTAGTGGATTTT
CTCAAGACCCCTTCAGGCATCAAGTTGACCATCAACAAACTCCTGGACATGGCAGCCCAA
ATTGCAGAAGGCATGGCATTCATTGAAGAGCGGAATTATATTCATCGTGACCTTCGGGCT
GCCAACATTCTGGTGTCTGACACCCTGAGCTGCAAGATTGCAGACTTTGGCCTAGCACGC
CTCATTGAGGACAACGAGTACACAGCCAGGGAGGGGGCCAAGTTTCCCATTAAGTGGACA
GCGCCAGAAGCCATTAACTACGGGACATTCACCATCAAGTCAGATGTGTGGTCTTTTGGG
ATCCTGCTGACGGAAATTGTCACCCACGGCCGCATCCCTTACCCAGGGATGACCAACCCG
GAGGTGATTCAGAACCTGGAGCGAGGCTACCGCATGGTGCGCCCTGACAACTGTCCAGAG
GAGCTGTACCAACTCATGAGGCTGTGCTGGAAGGAGCGCCCAGAGGACCGGCCCACCTTT
GACTACCTGCGCAGTGTGCTGGAGGACTTCTTCACGGCCACAGAGGGCCAGTACCAGCCT
CAGCCTTGAGAGGCCTTGAGAGGCCCTGGGGTTCTCCCCCTTTCTCTCCAGCCTGACTTG
GGGAGATGGAGTTCTTGTGCCATAGTCACATGGCCTATGCACATATGGACTCTGCACATG
AATCCCACCCACATGTGACACATATGCACCTTGTGTCTGTACACGTGTCCTGTAGTTGCG
TGGACTCTGCACATGTCTTGTACATGTGTAGCCTGTGCATGTATGTCTTGGACACTGTAC
AAGGTACCCCTTTCTGGCTCTCCCATTTCCTGAGACCACAGAGAGAGGGGAGAAGCCTGG
GATTGACAGAAGCTTCTGCCCACCTACTTTTCTTTCCTCAGATCATCCAGAAGTTCCTCA
AGGGCCAGGACTTTATCTAATACCTCTGTGTGCTCCTCCTTGGTGCCTGGCCTGGCACAC
ATCAGGAGTTCAATAAATGTCTGTTGATGACTGTTGTACATCT

Protein Sequence

>3932 : length: 516
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQGDPRQQGLKDKACGSLAVGFHLSPTYFLPGLAFLVPHPVTPGFLPIPARFSLMPLVFT
DNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSL
EPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYK
IRNLDNGGFYISPRITFPGLHELVRHYTRYYNGHTKVAVKSLKQGSMSPDAFLAEANLMK
QLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMA
FIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAIN
YGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLM
RLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP