ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

3925

Name

STMN1

Synonym

C1orf215|LAP18|Lag|OP18|PP17|PP19|PR22|SMN;stathmin 1;STMN1;stathmin 1

Definition

leukemia-associated phosphoprotein p18|metablastin|oncoprotein 18|phosphoprotein 19|phosphoprotein p19|prosolin|stathmin|stathmin 1/oncoprotein 18|transmembrane protein C1orf215

Position

1p36.11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling mediated by p38-gamma and p38-delta;PID Curated;200143

Pathway

Aurora B signaling;PID Curated;200010

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Cytoskeletal regulation by Rho GTPase;PANTHER;P00016

Pathway

stathmin and breast cancer resistance to antimicrotubule agents;PID BioCarta;100027

Disease

Squamous cell cancer;FunDO

Disease

Epstein-Barr virus infection;FunDO

Disease

Malignant glioma;FunDO

Disease

Multiple sclerosis;FunDO

Disease

Yersinia infection;FunDO

Disease

Down syndrome;FunDO

Disease

Lung cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

3925

Links to epithelial mesenchymal transition gene database

3925

Links to ovarian cancer gene database

3925

Links to endometrial cancer gene database

3925

Links to iHOP

3925

Sequence Information

Nucleotide Sequence

>3925 : length: 2251
GCTCTCGGCCAATGCGGAGCCCCGCGCGGAGGTCACGTGCCTCTGTTTGGCGCTTTTGTG
CGCGCCCGGGTCTGTTGGTGCTCAGAGTGTGGTCAGGCGGCTCGGACTGAGCAGGACTTT
CCTTATCCCAGTTGATTGTGCAGAATACACTGCCTGTCGCTTGTCTTCTATTCACCATGG
CTTCTTCTGATATCCAGGTGAAAGAACTGGAGAAGCGTGCCTCAGGCCAGGCTTTTGAGC
TGATTCTCAGCCCTCGGTCAAAAGAATCTGTTCCAGAATTCCCCCTTTCCCCTCCAAAGA
AGAAGGATCTTTCCCTGGAGGAAATTCAGAAGAAATTAGAAGCTGCAGAAGAAAGACGCA
AGTCCCATGAAGCTGAGGTCTTGAAGCAGCTGGCTGAGAAACGAGAGCACGAGAAAGAAG
TGCTTCAGAAGGCAATAGAAGAGAACAACAACTTCAGTAAAATGGCAGAAGAGAAACTGA
CCCACAAAATGGAAGCTAATAAAGAGAACCGAGAGGCACAAATGGCTGCCAAACTGGAAC
GTTTGCGAGAGAAGATGTACTTCTGGACTCACGGGCCTGGGGCCCACCCAGCACAGATCT
CTGCTGAGCAATCTTGTCTCCACTCTGTTCCTGCCCTTTGCCCAGCCCTGGGCCTCCAAT
CTGCATTGATTACCTGGTCTGATCTCTCTCACCATCACTAGGTACTTAATAAATATTTGC
TGTTGATGATAGCAATGACCTTGAGACTGATGAACAGTCTGGCCAAGAGGATCCTTGATG
TGGAAGATAGAAAAAGCCTTTGGGGTCAGGCAGACTTGGATTCTAATACCAGCCAGTTCT
GCTTGCTGTGTCTGAGCCTCAGTTTACTCATCTGTGAAGAGGAGGTAGCAAGAATGAAAA
TGCCTGCCTTGTGGTTTGTTGTAAGGACAGACACTGCCAACGTAGAGGGCCCAGCAGCTC
ACAGACCAGTTGCTCTGAGAGCAGACCACTCTTGCCTTGATGGTAGGGAACTATTTTTGT
GCGTGGCAAGTGGGACCTTAGGAAGGAAGGCAACTGTGAGGCTTCTGAGAAGGACCCTAC
ACAAGGGAGTTTCCTCCCAGGGCAGGTGAATGGAGAGGGTGGCAGAAGCCTACGGGAAGG
GGTCACAGGGATCAGCTAGAGAGTGCCACCACCCTTCCTGGGGAATGCAGGGCAAGGTCC
CTGGTGGGAGTTTTCCTGGGAAGCCAAAGAAGCGCCCAACAAAGACAGAATCAACATTTG
GGTACCTTTGGTACCCAGAGGCAGCAATGCCAACTACAACCACACTGGAAGAAGAAGACC
TTCTCCGCATAGATTCTCTGATCTCTTCCTCCTTCATGGCACCAGCCCTGGGGAACCAGC
ATGGTGGGGAAATAATGAAGCTGGAATACAACCACTTACAGACTTCACAACCTCCTCCTG
TAGATACCAAAGGGATTTTAGGATCACATTTTATTTCTCACCTGAGCAAGAAAAGCTACA
GGAGCATCTCAAGCAGAGGGCAGGAGTCTCCAGAGGAGTTCAAGGGGCTCTGGCAAGAAA
AATCAAGGGGCTGTGTTCAAGAACTGGCTCCCTTGGTGATTGTATTACGAAGCCCATGTG
TGCTGGATGCTGATGAAATTGCTGCCAAATGCCTGTGCAGCCTTGGCAAGGCCCTTTATT
TCTCTGGGTCTCCATTTCTCTCTCTCTTTTTTTTTTTTTTTTTTTTTTGAGGCAGAGTCT
CACTCTGTCGCCCAGGCTGGAGGGCAGTGGCGTGATCTCGGCTCACTGCAAGCCCCACCT
TCTGAGTTCACGCCATTCTACTGCCTCAGCCTCCCGAGTAGCTGGGACTACAGGCGCCCA
CCACCACGCCCGGCTTATTTTTTGTATTTTTAGTAGAGACGGGGTTTCACCGCATTAGCC
AAGATGGTCTCGATCTCCTGACCTCGTGATTCACCCACCTCAGCCTCCCAAAGTGCTGGG
ATTACAGGCATGAGCCACTGCGCCCGGCCTGGGTCTCCGTTTCTCTAGCTGTGAAATGAC
TGTTCTAAAAGAGCCCTGCCGGACTTTGGCAGTCTGTAAGAAGACCTGAGTTCTTCTCTC
AGTTCCAAGCAGGAAAATTGAACATACCCTGAGCCCAGAGCCTGCAACAAACTCTGGGCA
GCCTCAGGAAGTCAGGCAGTGAAGTCGGAAAAATGATCTCTTCTGTATAGGGAGAAAATA
AAAGTTTAAAAATTTGTAAAAAAAAAAAAAA

Protein Sequence

>3925 : length: 174
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKMYFWTHGPGAHPAQISAEQSCLHSVPALCPALGLQSALITWSDLSHHH