ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

389692

Name

MAFA

Synonym

RIPE3b1|hMafA;v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog A;MAFA;v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog A

Definition

pancreatic beta-cell-specific transcriptional activator|transcription factor MafA|transcription factor RIPE3b1

Position

8q24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Maturity onset diabetes of the young;KEGG PATHWAY;hsa04950

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

Pathway

Regulation of gene expression in beta cells;PID Reactome;500522

Pathway

Insulin Synthesis and Processing;PID Reactome;500128

External Links

Links to cell senescence gene database

389692

Links to epithelial mesenchymal transition gene database

389692

Links to ovarian cancer gene database

389692

Links to endometrial cancer gene database

389692

Links to iHOP

389692

Sequence Information

Nucleotide Sequence

>389692 : length: 2373
GCGCGGCCGGGCGCGGGCCCCGGGCGATGGCCGCGGAGCTGGCGATGGGCGCCGAGCTGC
CCAGCAGCCCGCTGGCCATCGAGTACGTCAACGACTTCGACCTGATGAAGTTCGAGGTGA
AGAAGGAGCCTCCCGAGGCCGAGCGCTTCTGCCACCGCCTGCCGCCAGGCTCGCTGTCCT
CGACGCCGCTCAGCACGCCCTGCTCCTCCGTGCCCTCCTCGCCCAGCTTCTGCGCGCCCA
GCCCGGGCACCGGCGGCGGCGGCGGCGCGGGGGGCGGCGGCGGCTCGTCTCAGGCCGGGG
GCGCCCCCGGGCCGCCGAGCGGGGGCCCCGGCGCCGTCGGGGGCACCTCGGGGAAGCCGG
CGCTGGAGGATCTGTACTGGATGAGCGGCTACCAGCATCACCTCAACCCCGAGGCGCTCA
ACCTGACGCCCGAGGACGCGGTGGAGGCGCTCATCGGCAGCGGCCACCACGGCGCGCACC
ACGGCGCGCACCACCCGGCGGCCGCCGCAGCCTACGAGGCTTTCCGCGGCCCGGGCTTCG
CGGGCGGCGGCGGAGCGGACGACATGGGCGCCGGCCACCACCACGGCGCGCACCACGCCG
CCCACCATCACCACGCCGCCCACCACCACCACCACCACCACCACCACCATGGCGGCGCGG
GACACGGCGGTGGCGCGGGCCACCACGTGCGCCTGGAGGAGCGCTTCTCCGACGACCAGC
TGGTGTCCATGTCGGTGCGCGAGCTGAACCGGCAGCTCCGCGGCTTCAGCAAGGAGGAGG
TCATCCGGCTCAAGCAGAAGCGGCGCACGCTCAAGAACCGCGGCTACGCGCAGTCCTGCC
GCTTCAAGCGGGTGCAGCAGCGGCACATTCTGGAGAGCGAGAAGTGCCAACTCCAGAGCC
AGGTGGAGCAGCTGAAGCTGGAGGTGGGGCGCCTGGCCAAAGAGCGGGACCTGTACAAGG
AGAAATACGAGAAGCTGGCGGGCCGGGGCGGCCCCGGGAGCGCGGGCGGGGCCGGTTTCC
CGCGGGAGCCTTCGCCGCCGCAGGCCGGTCCCGGCGGGGCCAAGGGCACGGCCGACTTCT
TCCTGTAGGCGCCGGACCCCGAGCCCGCGCCGCCGTCGCCGGGGACAAGTTCGCGCAGGC
CTCTCGGGGCCTCGGCTCGGACTCCGCGGTACAGGACGTGGACACCAGGCCCGGCCCGGC
CGTGCTGGCCCCGGTGCCAAGTCTGCGGGCGCGGGGCTGGAGGCCCCTTCGCTCCCGGTC
CCCGTTCGCGCGCGTCGGCCCGGGTCGCCGTCCTGAGGTTGAGCGGAGAACGGTGATTTC
TAAGGAAACTTGAGCCAGGTCTAACTTCTTTCCAAGCGTCCGCTTGTACATACGTTGAAC
GTGGTTCTCCGTTCCCACCTTCGCCCTGCCAGCCTAGAGGGACCGCGCTGCCGTCCCTTC
CCGGGTGGCCCCTGCCTGCCCCCGCCCTCCTTCGTTCTCTTCTCAGCCTCCCTTTCCTTG
CCTTTTTTAACTTCCCCTCCCCGTTTTAAAATCGGTCTTATTTTCGAAGTATTTATAATT
ATTATGCTTGGTGATTAGAAAAGAAAACCTTGGAGGAAGCCCCTTCTTTCCCCAGCCGGG
GTCCGCCCTCAGTCGCGAGTCACAGCATGAGTCGCTCGCCAGGAGGGGCCCGGCCCCTGC
CTGCCCCCTCCCCGCTTGCCCCCGACCCTGCTACCGGCGTTCCTTGGAGGTCGAAGCCAG
GGACGTCACCCGTGCTGTGTCCAGGCCTGCTGTCCTACTATGCTCAACCGGGGGTGGGGG
GAGGGGGGTGAGTCCTGTGCTCAGTCGGGTGGGGGCTGGCCCGGATCCCGAGCTGCTGTC
TCTCTATGCACCAGAACATATCTGTAACTCCTGGGGAAATACATCTTGTTTTAACCTTCA
AGAGAAGTGAAAGAAAAAAGTAATGCACAGTATTTCTAGCAGAAAATTTTTTTTTTTAAG
AGGAGGCTTGGGCCAGAGCCTTCTGGCATGGGGCGGGTGGAGAAAGTGTTTTTATTTTAA
TTTAAATTGTGTTTCGTTTTGTTTGTGGAATCTTTCTTTAATGCTTCGTCGCTCTTTGGA
CTAGCCGGGAGAGAGGGCGAGGAGGCGGGTGCTCCAGGCCCTGTAGGCTGGGCCAGGCGC
CTGGGGGATCTGCCCGTTTTCGGAGGCCCTCAGGGGCCATCAGTGGGATTCCAGCCGCTC
CACACCCCTCCCCTGAGCACTCGGAGTGGAAGGCGCGCCGACTCGTTGAAAGTTTTGTTG
TGTAGTTGGTTTTCGTTGAGTTCTTTTTTCATTTGCTACGAAACTGAGAAAAAGAAAAAA
ATACACAAAATAAATCTGTTCAGATCCAAGTCA

Protein Sequence

>389692 : length: 353
MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCS
SVPSSPSFCAPSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMS
GYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAAAAAYEAFRGPGFAGGGGADDM
GAGHHHGAHHAAHHHHAAHHHHHHHHHHGGAGHGGGAGHHVRLEERFSDDQLVSMSVREL
NRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEV
GRLAKERDLYKEKYEKLAGRGGPGSAGGAGFPREPSPPQAGPGGAKGTADFFL