ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

389549

Name

FEZF1

Synonym

FEZ|HH22|ZNF312B;FEZ family zinc finger 1;FEZF1;FEZ family zinc finger 1

Definition

fez family zinc finger protein 1|zinc finger protein 312B

Position

7q31.32

Gene Type

protein-coding

External Links

Links to cell senescence gene database

389549

Links to epithelial mesenchymal transition gene database

389549

Links to ovarian cancer gene database

389549

Links to endometrial cancer gene database

389549

Links to iHOP

389549

Sequence Information

Nucleotide Sequence

>389549 : length: 3859
CACCCGCGCGGGGCGCTTAAAGCTTCGCGTTGTTTCCAGGAGCCTTTTCCTCTGTGTGGG
ACTGCTGAGAAACTATGAGGGCAGCCCCACTGTTCGTGAATTCAGAGAATTAACTGAACT
TGAAGTAAGAGGAGACAGTGGGAAGAGGGAAAAAAAAAATCTTCTAAATTAATTTAAAGT
GAGAAGGCAATAACATTTTAAAAGGTAGTAAGATTTCTTAATGATGGATCAAGCCTCTTC
TTGGGATTGGATCTTAGTGCTCAACTCTTGAAACATGCACAAGGCGTGCAGAATCTGGTC
TGGGAGAGGCCTAAGGGCGGGAAGGGAGGAAACAGAACAGCATCCACTTCCATCAACAAA
AGGGGGCCGGCCAGTGGCTGAGTGCTTCCTCTTTTACAGAGGCTATGGAGGCCCGCGAGA
GGTGGCCACGGGGTATGGCCCTCTTTGGACAGCCATGAAATACTCTCTTTTAGAGGAGAT
GCAGGGTTTCACTGGGAGAACTCGGGAATGAAAGAACAAATTGGAGAGTAAAGCCAAAGA
AGGGAAGGTAGAAAGGCCTTTCTGTTAAGGTCTTAAACAGGAGAATCTAGTTAGAAAATT
CTCTTTGCCCTGGGACCATAAGGAGACCCCAACTACTCTTAAGCACAGGCCAAACGGCTT
CAAAAGGGAGGATTCTCGGAGGAAGGAGGTCGGCTAAAAAAATACACGAAAGGTTTTTGG
AAGAGATACTCAGAGATGCTTCTCAGACATTCTTAAAATTTGACTTAAGAACGTATTTTC
CAGGAAAGTCAAAATGACAGGCAAACCTAGTGAAAAGATGCTCTAGTTCCTCCTTAGGTA
TGCCACACCCCCGGGCCTGTTTTCTTTCACCTTGCGTCTAGATTAAATGACCCTTCAATT
ACACCCTGAGTCGTCAAAGCAAGTCTATTAGCGAGTGCCTGTTCAAAAACTTTCATCCAG
GAGCTCTCCACCATCTGTTCCGCGGTCTCTTAAACCAGATCCGGCGCCCCCTCCCGAAAC
TCTTTGGAGCCTCCCTCGCCATCTCTCAGCCTTGGGGGGATGGAGCCGCCCCAGGACCTG
CGGGAATGCAGAGGAGAAGGGGAGGAGCGCGATTGCGCCCGGGATGGGTTGCCAGACCAG
CTGGGGCGGTGGTGGTCCAGAGGCCCGAGGTCGGCGGGACCTGATCGAAGGCAGCGCCGC
GTCGACCACCCCGGGAGCCGGACGCTTGGGAGCCCCAGCCCGGCAGCGGCGCCCGGTCAC
TGAAGTTGCGCCCCAACTCCCAGCCGCCTCCAAGCTTCTCGAGCTAAGTTTCCTGACCCC
TCCAAGGGAGTCTCACAGAGCTCGGTGGCCCTCGGCCTTGCCAACGTCACTTTAACTGTT
TGGAACTCGTGAGCAAGAACCGAGAAGTGGAGAGCCCAGCCGGGGAGTTTTCAGCTTTTC
TGTTTCACTTCGGGCTTCTTCTATTCAAATGGCTCTGCGCTGGCCACCGAATCCTGAATG
AGGCGGGGCTCCTCTGCCCCAACTCCAGCAGCGGGAACTTGGTTCCCCTGGGCAGCCGGG
GGCAGGGGGCGCCAAGGCCGTGGCGATAATGAAGGCTGAGACGGCCAAGGCCAGCGGGTC
GGCGCGGGGCACTCCCGGGCCGGAGTGGCCATCGGCCGGAGTTCAGGAGGTCTGTGACAA
GCAGGGAACAAGGCAACGGACGGCGCAACCCAGCCCCGGCTGACGGACGCTGGCGACTCA
GACATGGACAGTAGCTGCCACAACGCGACTACCAAAATGTTAGCGACTGCTCCAGCTCGG
GGCAACATGATGAGCACGTCCAAACCCTTGGCTTTCTCCATTGAACGAATCATGGCGCGC
ACCCCAGAGCCCAAGGCCCTGCCAGTCCCCCACTTCCTGCAGGGAGCCTTACCCAAGGGG
GAACCCAAGCACTCTCTGCATCTCAACTCGTCGATCCCCTGCATGATCCCCTTCGTGCCT
GTGGCCTACGACACGAGCCCCAAGGCAGGAGTGACGGGCTCCGAGCCGCGGAAGGCCAGT
CTGGAGGCCCCGGCGGCGCCCGCGGCGGTGCCCTCGGCTCCCGCATTCAGCTGCAGCGAC
CTGCTCAACTGCGCACTGAGTCTCAAGGGCGACCTGGCCCGCGACGCGCTGCCGCTGCAG
CAGTACAAGCTGGTAAGGCCGCGTGTGGTCAACCACTCTTCATTCCACGCCATGGGCGCC
TTGTGCTACCTGAACCGAGGTGACGGCCCATGCCACCCGGCAGCCGGCGTGAACATCCAC
CCGGTGGCCTCCTACTTCCTCAGTTCCCCTTTGCACCCGCAGCCAAAAACGTATTTAGCC
GAAAGGAATAAACTGGTGGTCCCGGCGGTGGAGAAATACCCTTCTGGAGTAGCTTTCAAA
GACCTGTCCCAGGCTCAGCTGCAGCATTACATGAAAGAAAGCGCCCAGCTTCTGTCGGAA
AAAATCGCGTTCAAAACCTCGGATTTCAGCCGAGGCTCTCCTAATGCCAAGCCCAAAGTT
TTCACTTGCGAAGTGTGTGGAAAGGTCTTTAATGCGCACTATAACTTAACCCGTCACATG
CCAGTGCACACAGGAGCCAGACCCTTCGTTTGCAAAGTGTGCGGAAAAGGTTTCAGGCAA
GCAAGCACCCTGTGCAGGCACAAGATCATTCACACGCAGGAAAAACCTCACAAATGTAAC
CAGTGTGGCAAAGCATTTAATAGAAGTTCCACTTTAAACACTCATACCCGAATACACGCG
GGCTACAAACCGTTTGTGTGTGAATTCTGTGGCAAAGGGTTTCATCAAAAAGGGAATTAC
AAAAACCACAAGTTGACCCACAGCGGGGAGAAGCAGTTCAAGTGCAATATCTGCAACAAG
GCTTTCCACCAGGTTTACAACCTCACCTTCCACATGCACACCCACAACGACAAGAAGCCT
TTCACCTGCCCCACGTGCGGCAAGGGTTTCTGCAGGAACTTTGACCTCAAGAAGCATGTC
CGCAAGCTGCACGACAGCAGCCTGGGGCTGGCCCGCACGCCAGCTGGCGAACCAGGCACT
GAACCGCCGCCCCCGCTACCGCAGCAGCCGCCGATGACGCTGCCTCCTCTGCAGCCGCCG
CTGCCAACCCCGGGGCCCCTGCAGCCCGGGCTCCACCAGGGCCACCAGTGATCGAGGCTA
AGGGTCCTCCCAGCCTCAGCCGTGCCCCCACGCTGAGGCAGCGGCAGACTAGAGCTCCTG
GTCCGAGTTCGTCTGCAGACCCCAGGGCATGTTGGGCCCCACACTTCAGGGCCGACCAGA
AGCCTCTGCATCCCCTGGCCTTTCGCCTCTTGCATGCACCTGCTAAATGGTTTTGTGTAT
TATATTCTATATAGGCACTAACAATTATGAAAAATTTGGAGGGTTTTGCTTGTTTTCTGT
TTTTCTTTTTCTTTTTTTTTAATTTGGAAAGACTTTTCATCTTGGGTGGAGAGATGGTGT
TTATTTTGTTTTGTTTTGTTTAAACAAATTTCTGCTATATTTATTGAGATCTGTATTATT
CTACCCGGGAATGCTGCATCATTTTAATTTTATTATTGTATATATTTCCATTGTGTTGAT
TCTCCGGTCTCAAGATGTCTGCTGGATGTTGATCATTTCCTCTTTCCCTGAAGTAACAAA
ACACTGTGTGTATGTCATATATACACGCATAGATGTGTGCGCCCATAGGGGTACATTCCA
CATTCGTGAGCACACACCCATACACATTAGATAAGGGTGGTTCATTATGGATGATTTTGA
ATTTTGGTTTTGATTATTGCACGTGAAAATTGATTCATTGACTGTTGGAAATAAATACTT
GGAACATGCTTATTTAATC

Protein Sequence

>389549 : length: 475
MDSSCHNATTKMLATAPARGNMMSTSKPLAFSIERIMARTPEPKALPVPHFLQGALPKGE
PKHSLHLNSSIPCMIPFVPVAYDTSPKAGVTGSEPRKASLEAPAAPAAVPSAPAFSCSDL
LNCALSLKGDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAAGVNIHP
VASYFLSSPLHPQPKTYLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEK
IAFKTSDFSRGSPNAKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQA
STLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYK
NHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVR
KLHDSSLGLARTPAGEPGTEPPPPLPQQPPMTLPPLQPPLPTPGPLQPGLHQGHQ