ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

389421

Name

LIN28B

Synonym

CSDD2;lin-28 homolog B (C. elegans);LIN28B;lin-28 homolog B (C. elegans)

Definition

Lin-28.2|lin-28B|protein lin-28 homolog B

Position

6q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Height;NHGRI

Disease

REPRODUCTION;GAD

Disease

menarche and menopause (age at onset);GAD

Disease

Digit length ratio;NHGRI

Disease

Menarche and menopause (age at onset);NHGRI

Disease

Digit length ratio;GAD

Disease

Menarche (age at onset);NHGRI

Disease

menarche (age at onset);GAD

Disease

DEVELOPMENTAL;GAD

Disease

height;GAD

Disease

timing of puberty;GAD

External Links

Links to cell senescence gene database

389421

Links to epithelial mesenchymal transition gene database

389421

Links to ovarian cancer gene database

389421

Links to endometrial cancer gene database

389421

Links to iHOP

389421

Sequence Information

Nucleotide Sequence

>389421 : length: 5517
AATTGACAAAGTCACGTGTGCTCAGGGGGCCAGAAACTGGAGAGAGGAGAGAAAAAAATC
AAAAGAAGGAAAGCACATTAGACCATGCGAGCTAAATTTGTGATCGCACAAAATCAAGAT
GTTAGATTGATGCAGAAGATCACTCCGTTCCAAAGGGAAAGTTTTCATCTCACGAGTTTG
GAGCTGAGGGCCCGTGGGGCAACATGGCCGAAGGCGGGGCTAGCAAAGGTGGTGGAGAAG
AGCCCGGGAAGCTGCCGGAGCCGGCAGAGGAGGAATCCCAGGTTTTGCGCGGAACTGGCC
ACTGTAAGTGGTTCAATGTGCGCATGGGATTTGGATTCATCTCCATGATAAACCGAGAGG
GAAGCCCCTTGGATATTCCAGTCGATGTATTTGTACACCAAAGCAAACTATTCATGGAAG
GATTTAGAAGCCTAAAAGAAGGAGAACCAGTGGAATTCACATTTAAAAAATCTTCCAAAG
GCCTTGAGTCAATACGGGTAACAGGACCTGGTGGGAGCCCCTGTTTAGGAAGTGAAAGAA
GACCCAAAGGGAAGACACTACAGAAAAGAAAACCAAAGGGAGATAGATGCTACAACTGTG
GTGGCCTTGATCATCATGCTAAGGAATGTAGTCTACCTCCTCAGCCAAAGAAGTGCCATT
ACTGTCAGAGCATCATGCACATGGTGGCAAACTGCCCACATAAAAATGTTGCACAGCCAC
CCGCGAGTTCTCAGGGAAGACAGGAAGCAGAATCCCAGCCATGCACTTCAACTCTCCCTC
GAGAAGTGGGAGGCGGGCATGGCTGTACATCACCACCGTTTCCTCAGGAGGCTAGGGCAG
AGATCTCAGAACGGTCAGGCAGGTCACCTCAAGAAGCTTCCTCCACGAAGTCATCTATAG
CACCAGAAGAGCAAAGCAAAAAGGGGCCTTCAGTTCAAAAAAGGAAAAAGACATAACAGG
TCTTCTTCATATGTTCTTTCCTTTACCCGGTTGCAAAGTCTACCTCATGCAAGTATAGGG
GAACAGTATTTCACAAGCAGTAGCTGACCTGGGATTTTAACTACTATTGGGGAACTGTGA
ATTTTTTAAACAGACAAATCACTCTAAGCAAATTACATTTGAGCAGGGTGTCATGTTTTA
TGTTAATTCAGAGAATAAGATACTATGTCTGTCAATATGTGCATGTGTGAGAGGGAGAGA
GCCTGAGTCTGTGTGTGTACATGAGGATTTTTATATAGGAATGTAGACACATATATAAAG
AGGCTTTGTCTTTATATATTTGTGTATAGATCAAAGCACACACCCTCTCTCATATAATTG
GATATTTCCAAGAATTGAAAACCCATGTGAAGCATTATAGATAGTTTTAAATTTAACCCA
CTGGAGTTTTCTTGAAATACCACTTCTTTTATATTATATAAAACTAAAAACACGACTGTT
ACCTTTTGTGTGAACCAAAGGATACTTCAGATCTCAGAGCTGCCAATTATGGGGTACTAA
AGGTTTTTAAGACATCCAGTTCTCCCGAATTTGGGATTGCCTCTTTTTCTTGAAATCTCT
GGAGTAGTAATTTTTTTCCCCCTTTTTTGAAGGCAGTACCTTAACTTCATATGCCTCTGA
CTGCCATAAGCTTTTTTGATTCTGGGATAACATAACTCCAGAAAAGACAATGAATGTGTA
ATTTGGGCCGATATTTCACTGTTTTAAATTCTGTGTTTAATTGTAAAATTAGATGCCTAT
TAAGAGAAATGAAGGGGAGGATCATCTTAGTGGCTTGTTTTCAGTAGTATTTTAATATCA
GCTTCTTGTAACCTTTTCCATGTTGTGAGGGTTGTAAGGGATTGTGTGGCAACAGCAGCT
TCCCTTGGCTAACTCAATCTTCTACCCATTGCTTAGAGCAGGGAGCCCTCCTTATTTACT
ACTGAAGACCTTAGAGAACTCCAATTGTTTGGCATATATTTTTGGTGGTGGTTTTTATTC
CTCCTGGAGAGTTATCTAATTTGTTTCTAAAACAAACAAGCAGCAAAGAAATGAATTAAA
TACTGGGGTTGAGAATTAAAATTAAGTGGATGTTCACAGTTGCCCAATATATATGACCTG
CAAATGATACGAAAAAGTGCAGCATTTAGTGGCAGTTAACAAGAGTGACAAGCCTGGGGC
AGAGGTACCAAACCTCTCCCACCAGAGAGCTAGAAGTATTTTATACAGTAACTTTGATCT
TATGGAAGTGACCTTCAATGCTTATTCTGAAGTAACCTATATGGTGGATACAGGATGAAC
ATTCAGTGCCAGGGAGAATCTTCTCAGGTTGGTTCTCGTTAGAGTGATAAACTGGCTAGG
GGCCATAGTATTGGTCCTGTTAGGTTTCGGTCATGGAAAAAAAAATTATTTTGGGGTCAT
CCTGGCTCTAGATGTTATGGGCAAATTTCTGAAACATCTGCAAGAAGGTACCAGTTAATT
ATAGTGCTTAATATTGGGAATAAGATTAAGCATTATAATTATAATGTATGGGCCTGTTGG
TGTAAGCTCAGATAATTAAATAAAAATAGCATGACTCAAATGAGACATATTCTGCTGAAC
AGTTTCTACTTCCTCTCCCGCCTGTCCTGTCATGGGAGACGTGTATAGTTGCTGCTGTTT
CAGCAAACCACCATAAGACGAAAATGCCTCAGGTTGGGTTGCCAGTCCTTTACAACTCAG
CTTGAATTTCACAACAGTGATTGTGAGAATCTGCGTGGTATACACTGAAATATCGGTGTG
CTGTGATGCAAAGCTTACCTTTGACGATATTGAATGTGATATAGCTGTAGAGAAGTACTT
CCTTGCCTTATGTGAGGATTTCAAACTTATTTAAATTATGTAGACAAATCAAAGTGGCAT
TGCTTAATTTTTAGCAGGCATAATAAGCAAGTTAACAGTAAAATGCAAAACATGATAAGC
GTTGCTCAATTTTTAGCAGGTATAATAAGCAGGTTAACAGTAAAAATGCAAAACATGATA
GATAAGTCACTTTGAAAATTCAAACCAAAGTTCCTTCACCTTATGGAAATAGGAAATTAT
GGACTTCAAAATTGGACACTTCCTGTTTACAAAAAGAAATTCAGAGCTAAAATCATGGTA
AAAAAAAATAGAAACACTTGAGAACTATGGTCTTTATGGGTGCAATTTGAAATCCTTTTC
ATCATCTTACCAGACTAAACTAAGAGCACATACCAAACCTATCTTATGGTTGAAAGTTGG
GGTTTATTTTTTATATGAGAATATTATCACTATTACATAACATACTCAGGACAAAGAACT
TTGCTCAGGGAACATACCATGTAATATTTTTGTTGTTTCTTTACAGACTAGTCTACAGTC
CTGCTTACTCAAAACAAACCAAATAACTTATACCTTTATATAAGTATTATGTACTGATGA
TAGTAACTACCTCTGAGTTTGACACAGATCAAAATTTTTGAATATCAGATATCAGTTATC
CTATTTTTATTTCATGTGAAAACTCCTCTAAAGCAGATTCCCTCAACTCTGTGCATATGT
GAATATCACTGATGTGAACACATTGTTCATTTACATAGGTAAAATATTACTCTGTTTACA
GCAAAAGGCTACCTCATAGTTGATACATAGCACACCTGTATGTATGCTGTTCCAGCCTTA
CAGGTGGCTGATAATTCTCTGGTACAGAACCTTTTTATCTGTATTATAAATAGCAATTCA
CAACTGCATGTTTCTGACAAACACTTGTGAATAATGAAGCATCTCGTTTTAGTTAGCAAA
GTCTCCAAACATTTCCTTAAAATAATCATGTATTTAGTTTAAAGAATTATGGGCACTGTT
CAACTTAAGCAAAACAGAACACGGAAGCAGTCTTAGAAGCACCACTTTGCCCAGAGGTGG
AGGTTGGAAGGGGTAGCAGGGAGAGGGGTTGGTGTATGCAGGTATTCATGCTAGGCAAAG
AGTTTAAAAGACGCCAATGTCCTTCATTTACTGTCTGTGCTGCCCTGAAGCCAAGCGTAT
TGCAGCATTATAGCCCCAGGCACATAACTAACTAGCACTGGCTTGCCAAGGAATGAACAT
GCAATGCCATTACTAGCTATTGAGGGAAAAGGGTCTGTGTGAAGCATCACTTTGCAGGGA
TTACTAATGGTGGGGCAGCAGGTCTGTGAATTAAGTTATCTCTTGACCTCACCCTCATGT
CAACACAAATGTAATTCCTAAACAAGATGCATTGCCAGTCTCTTAGCCCTGTAAGCTGAT
CTTTTGCTACATGGCAGACTATAATGAAAACATTTTTATACTTGGGTTTCTAGTCTTCAC
TAGAAGGCCTTGGATGTATTTTTGCAGTTGAAAGATTTAGAAAGATTTTTACCTGCTTAT
AACTTGGAAGTTTAGAGTGCAATGTAAGAAAAAAGATCAAGAAATGTCATGTTATTAGCA
TCAGTCCACCTCCAATATTGCCGATACTTTTTTTATTCTGGCTCAGTTTTATTTTGCACC
AGTGCGGCCCCAAGTTACTGCTGGTTGTATTTAGTTTGTGAATAGGAGCCCATAAGTGTT
AATAGACTTTGTAACATTCACTATAAGATGAATTATACAGGACATGGGAAATCTCATTAA
GTCTTAAAGTTAATTTAAATTAATTTATCTGTTTTCTCTAAGAAATGTTTATCATAAAAT
ATATATGTGTATTTCCCCTTTGGTTATAAAATTTGGGAAAGTATGTACAAGTGCAGCTGC
ACTGACTTTAATTTTCTAGATGTCTTAATGAGATTTATTTGTTTTAGAGAAGAACATCTT
GTTAAAAGCATCAAACTCTGTCTTACATAGCTGTCAACAGCCTCTTTAAGATGTGGTGGT
TGTATGATCTGTGTCTTAATTGTTCAGTTAGAGTGAGAAGTTGACCTATGATTCATTTTT
AAATTTTATATTTGGAACAAAGCTGCAAGTTATGGTAAAGTACTGTACTGTGAGAAGTAT
TATGATATTTAATGCATCTGTGGCTTAACACTTGTGAGAGTTACCAGCTTGAAAATGATG
GTGTTGACTACCTCTTGAATCACATCTATCAACCACTGGCACCTACCACCAAGCTGGCTT
CAATTAGTATGTGTTGCTTTTTGGTATTAACAACTAACCGTACTAGAGACCAAAGTGAAC
CCTGATTTTTATATGTCTTTAATAATGGTGTTTTATCTAGTGTTTTTAAATTATCCTGTG
TAGTATTTAGATTACCTCATTGTCCATTTTGACTCATGTTGTTTACAAGTGAAAATAAAA
ACACTTGAACTGTATGTTTTTAAAAGACAAAAAAGGGGTAGATGTTTGGAATGCGTTTCA
CTCGCATGCAGTCATCTGGAGGGACTGAAGCACTGTTTGCCTTTCTGTACACTCTGGGTT
TTATATTCTCATTTCATGCCTAATGTCTTATTCTGTCAATTATGGATATGTTGAGGTTTA
AAAAAATTACTTGATTAAAAATAAAACATATAACGTTGGCATTTAAAAAAAAAAAAA

Protein Sequence

>389421 : length: 269
MSHRRQVLQKRMRSFNQVSSAPGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRM
GFGFISMINREGSPLDIPVDVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTG
PGGSPCLGSERRPKGKTLQKRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMV
ANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQEARAEISERSGRS
PQEASSTKSSIAPEEQSKKGPSVQKRKKT