ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

389

Name

RHOC

Synonym

ARH9|ARHC|H9|RHOH9;ras homolog family member C;RHOC;ras homolog family member C

Definition

RAS-related homolog 9|oncogene RHO H9|ras homolog gene family, member C|rho cDNA clone 9|rho-related GTP-binding protein RhoC|rhoC GTPase|small GTP binding protein RhoC

Position

1p13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway;PANTHER;P00027

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Axon guidance mediated by Slit/Robo;PANTHER;P00008

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Cytoskeletal regulation by Rho GTPase;PANTHER;P00016

Disease

Cancer;FunDO

Disease

Skin disease;FunDO

External Links

Links to cell senescence gene database

389

Links to epithelial mesenchymal transition gene database

389

Links to ovarian cancer gene database

389

Links to endometrial cancer gene database

389

Links to iHOP

389

Sequence Information

Nucleotide Sequence

>389 : length: 1415
ATTGAAGGCTGGGCAGAGTCTGAGTCCACCCGGGTCGTGCTCCCCCCGCTCGCCCGGCTC
CTCCGCAGTCCAGGAATCTCCCCGTGGCTCTCCCCGACCTGGAGGGGTGGACGCCCCTGG
CCCCCAGTCCCCGGCCTGCGGAGGGGGCCGGTGGCTGCGGCCCTGCGCGGGGCCGGGGCG
GGCCGAGCCAAGGGCCGCCCCCGGCCGACCCTCCCCCTGCCGGGCCCGCCCTCCCCGCCG
CGGCGCTGGAGGAGGGCGGGGCGGGGCCCTGGGGTCAGTCTGAGCCTCCGGCACCGGCCG
CGCAGCTGGAGGCGGCGGAGCGGAAGCCTTGACTTCATCTCAGCTCCAGAGCCCGCCCTC
TCTTCCTGCAGCCTGGGAACTTCAGCCGGCTGGAGCCCCACCATGGCTGCAATCCGAAAG
AAGCTGGTGATCGTTGGGGATGGTGCCTGTGGGAAGACCTGCCTCCTCATCGTCTTCAGC
AAGGATCAGTTTCCGGAGGTCTACGTCCCTACTGTCTTTGAGAACTATATTGCGGACATT
GAGGTGGACGGCAAGCAGGTGGAGCTGGCTCTGTGGGACACAGCAGGGCAGGAAGACTAT
GATCGACTGCGGCCTCTCTCCTACCCGGACACTGATGTCATCCTCATGTGCTTCTCCATC
GACAGCCCTGACAGCCTGGAAAACATTCCTGAGAAGTGGACCCCAGAGGTGAAGCACTTC
TGCCCCAACGTGCCCATCATCCTGGTGGGGAATAAGAAGGACCTGAGGCAAGACGAGCAC
ACCAGGAGAGAGCTGGCCAAGATGAAGCAGGAGCCCGTTCGGTCTGAGGAAGGCCGGGAC
ATGGCGAACCGGATCAGTGCCTTTGGCTACCTTGAGTGCTCAGCCAAGACCAAGGAGGGA
GTGCGGGAGGTGTTTGAGATGGCCACTCGGGCTGGCCTCCAGGTCCGCAAGAACAAGCGT
CGGAGGGGCTGTCCCATTCTCTGAGATCCCCAAGGCCTTTCCTACATGCCCCCTCCCTTC
ACAGGGGTACAGAAATTATCCCCCTACAACCCCAGCCTCCTGAGGGCTCCATGCTGAAGG
CTCCCATTTTCAGTTCCCTCCTGCCCAGGACTGCATTGTTTTCTAGCCCCGAGGTGGTGG
CACGGGCCCTCCCTCCCAGCGCTCTGGGAGCCACGCCTATGCCCTGCCCTTCCTCAGGGC
CCCTGGGGATCTTGCCCCCTTTGACCTTCCCCAAAGGATGGTCACACACCAGCACTTTAT
ACACTTCTGGCTCACAGGAAAGTGTCTGCAGTAGGGGACCCAGAGTCCCAGGCCCCTGGA
GTTGTTTTCGGCAGGGGCCTTGTCTCTCACTGCATTTGGTCAGGGGGGCATGAATAAAGG
CTACAGGCTCCAACGTGAAAAAAAAAAAAAAAAAA

Protein Sequence

>389 : length: 193
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ
VRKNKRRRGCPIL