ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

387103

Name

CENPW

Synonym

C6orf173|CENP-W|CUG2;centromere protein W;CENPW;centromere protein W

Definition

cancer-up-regulated gene 2 protein|cancer-upregulated gene 2

Position

6q22.32

Gene Type

protein-coding

External Links

Links to cell senescence gene database

387103

Links to epithelial mesenchymal transition gene database

387103

Links to ovarian cancer gene database

387103

Links to endometrial cancer gene database

387103

Links to iHOP

387103

Sequence Information

Nucleotide Sequence

>387103 : length: 3561
ATGGCATTAGTGCTGTCGGAATCCTGATAAAACATCACAAACTTCTGTTCGTTGGTATTA
GGGACAGTATAGAGTGAGTGCTTGAAGAACTGCCTTGGCTTACCAATCTCTCTCTCCACA
ACTTCCAATCATCTCTAGGGAACCTAGCAGAAACACTTCCACAGAGCAAAAGTTATAATA
CAGAAAGTGATGAAAGGAGGACGCAGGCTCTCAATGACGTCAGGTATTCCCGGGACCCGC
CCACCGTGGGCGTTTTCCACCTACAGGCAGGCGTCTCCGGGGGCGGGGCTTGCTCAGGGT
TAACGTCACTACTGAGCGCCGGGCGCGTTCCGTTGGCGGCGGATTCGAACGTTCGGACTG
AGGTTTTTCTGCCTGAAGAAGCGTCATACGGACCGGATTGTTTTCGCTGGCCCAGTGTCC
CCGGAGCTTGTGTGCGATACAGAGAGCACCTCGGAAGCTGAGGCAGCTGGTACTTGACAG
AGAGGATGGCGCTGTCGACCATAGTCTCCCAGAGGAAGCAGATAAAGCGGAAGGCTCCCC
GTGGCTTTCTAAAGCGAGTCTTCAAGCGAAAGAAGCCTCAACTTCGTCTGGAGAAAAGTG
GTGACTTATTGGTCCATCTGAACTGTTTACTGTTTGTTCATCGATTAGCAGAAGAGTCCA
GGACAAACGCTTGTGCGAGTAAATGTAGAGTCATTAACAAGGAGCATGTACTGGCCGCAG
CAAAGGTATCTGAAAACTGAAGAGTGGAGAATATGTTCAGCAGGGAACAAGAGGATTCTT
TTAGAAATAAGAGGTAGAAGGTCACCTCAAATACCACAAAATGAATGGGAAGATGAACAC
TATGCAAGTACTCATTAAAAACATCCCAAAATGCTGGAGGAAATGCCGTGGAATTAAGGA
ATGACTCTTTTGTGGTAGAAAATTTTTATTTCAGAGTATAGACACTGCTTGTGCTGGGTC
TCTTAATTTTACTGGATATTATAATTTTCTTGGACTGTTAGATTTTCTCAGTGCAACATT
TCTGAGAGCAAATATGTTCTGCTCAATTAAATACTTTCTAAAGCTAGATAAATGCCTTCC
AGTAAGCACATTAACATTCAATATGTTATATTTTACCAGAGGTAAAACATTTATATTCTA
AAACATTATATTCTAAATTTTTTTACCCCAGGGAAAATAAAATGCCAAAAATCTCAACTA
CCACACATAGCTTTGTAATAAGATCAATGGGCAAATGGAATCAGCTTCAGTTTGCACTAA
TCCTACATATATGTATTAAGGATATGTGTAATGAACTTTGGCCATAATAAATTATAACTA
ATTTATTTCATCAGTTCACTACTATATTTCTTTCTTGTTTGCTTCTCCTCTTGTCGTCTC
TTCATATTTGGTAGAATATATTTTATTGAATATCTAGTTTCAGATTACCTGAGCTTCAGA
TTACATGGAATTTTGGACTGTTGAATACTTTTGATTGTGTAGTGGATATAACTAAGCAAT
TTTTTTTTTGGGGTGCATACTTAGAATGTAATTTCTGGATCTTTTGATAGGCATATTGTT
TTAGTTTGTTTTCTGCTTCTATAACATAATACTGTAGACTGGGTAATGTATAAAGAAAAG
AGATTTATTTCCCTCAGAGTTCTGGAGATTGTCCAAGATCAAGGGGCTGCATCTAGTGAA
ATCCTTCTTGCTGTGTCCTATATGGTGGAAAGCATCACATGGCAAGGAAGCATGCTTGTG
ACAGAGAGAATGAGAGCTGAACTTCATCTTTTTATCAGCAACCCCCTCCAGCAATAATTA
ACCCAATCCCACAATAATGGCCTTAATGTATTCATGTGGGCAGAGTCCTTATAACTCAAT
CACCTCTTGAAGGTCCCACTCTTAATGCTGTCGCAGTAGCAATTACATTTCAACATGAGT
TTTGGAAGGGATATTTAAACCATAGCATACATGTTTGCTATAAAAACGCCAGTTTTCCAA
GTGAATGTACCCATTTTAAACACCCACCAGAATCATTTGTGAGATCTAATTGTTCATTCA
ATCTTACTATACTTGGTATAGTCAATTATTTTAATTTTAGCACCATAATGAATATGTAGT
GATATTAAATTTGGTATTACTTTGCATTAATGACTAAAAATTAGATAACAAATGATATTG
AACTTATTTCCACATGCTTATTGATCATTTGGATATATTACTTTGTGAAGTTCATTTTTG
AAGCCTTTTGCCCATTTTTCTTTGTGTTGTATTTATTTTCCATACTCATCAAAAACATCC
CAAAATGCTAGAGGAAATGCTCTAGAATTCAGGAATAACTTCTTTTGTGGTAGAGAATTT
TTATTTCAGAGTATAGACACTGTTTGTGCTGGGTTTCTTAATTTTACTGGATATCATCAT
TTTCTTGGGCTGTTTGATCAAGTTTGATTTTCCCAGTGCAACATTTCTGAGAGTAAATAT
GGTCTGCTTAATAAAATATGTTCTAAAGCCAGATAAGTGCTTTCCAGCAAGTACAATTTT
CCTTCCAGCAAGTATAATACCTGGTTTATAAGCATTACATATATTAATATTATTATTTTG
TCAGATAGATATAATAAAAGTTTAATATTTCAATCTTTTATGGTAAGTGCTATTTATATA
CTGTTTAAGAAAGAGGCACCCATCATGACAATAATGTTCTATATTTTCCTATGAAAGTCT
TGTTTTATATTTCACATTTAGGTTTTGATGGTCCTTAAATATAAGATTTTTATACATGAT
ATTATGTATGGATTTAGGTTAATTTATTTTTATATGGATAGCCAATTGACCCAGAACCAC
TTATCAAAAAGACATCCTTTATACATTGAATTGCAATAGTGTTTTATCAAAACCAGCTAA
GTATTTTTGAGTGAGTGTATTTCTGAACTCTCTAATTTGTTTCATTTGTTTACCTTTTGT
TGTATTATTTCCTCACCATCTTAATTATTTTTAGCCTTATAAAAGCTTTGATATTTGGTA
GTATAAGTTTTCCTGTTTAGTTTTTCTTCTGTAATATTTTCTTGACTATATAAAGTCCTT
GCATTTCTATGTACATTTTAGAATAAAACTGTCAATTTGCACAAAATAACAGGCTGGGAT
TTGGATAGAGATTATGTTGATTTGAGGGAGATTGGCATTTTATCAATATTGTGTCTTTCA
GTCAATATACAGAGTATATCTATTTAGTTATTTTGATATTAATTTTTCTCACCAATGTTT
TATGGTCCTTAAGGAAAAAGCCTTGCAATGTTTCTATATATGTGATCCTAGGTAGTGGAC
CCTTTTAGATGTTATTATAAATGATTTTGCTTTTTAATTAAATTTCATTTTTCAGTTATT
TCTAGTATAAAGAAATGGAGGTGACTGATTATTGGAAACATTTATTTGTAAATTTTCTTA
TTTTTAATTTTTTTGTAGATTCTTGTAAATTTTCTGCAGAAAATTTATATTTTTTTCTGG
CTTTATTGAACTGCTTTGAAACTCCAGTGAAATGTTGAATAAAAGTGCTGATAATTGATA
TTAAAAAAAAAAAAAAAAAAA

Protein Sequence

>387103 : length: 103
MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVRFHPFSGWEWGTGEVHL
NCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG